UniProt ID | ATF3_HUMAN | |
---|---|---|
UniProt AC | P18847 | |
Protein Name | Cyclic AMP-dependent transcription factor ATF-3 | |
Gene Name | ATF3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 181 | |
Subcellular Localization | Nucleus . | |
Protein Description | This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.. | |
Protein Sequence | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | EVSASAIVPCLSPPG HCCHHHEEECCCCCC | 2.47 | 24719451 | |
21 | Ubiquitination | VSASAIVPCLSPPGS CCHHHEEECCCCCCC | 13.76 | 32015554 | |
23 | Ubiquitination | ASAIVPCLSPPGSLV HHHEEECCCCCCCEE | 7.63 | 32015554 | |
42 | Sumoylation | ANLTPFVKEELRFAI CCCCHHHHHHHHHHH | 45.94 | - | |
42 | Sumoylation | ANLTPFVKEELRFAI CCCCHHHHHHHHHHH | 45.94 | - | |
46 | Methylation | PFVKEELRFAIQNKH HHHHHHHHHHHHCHH | 23.41 | - | |
49 | Ubiquitination | KEELRFAIQNKHLCH HHHHHHHHHCHHHHH | 4.22 | 32015554 | |
52 | Ubiquitination | LRFAIQNKHLCHRMS HHHHHHCHHHHHHHH | 22.90 | 32015554 | |
59 | Phosphorylation | KHLCHRMSSALESVT HHHHHHHHHHHHHCC | 16.65 | 25627689 | |
60 | Phosphorylation | HLCHRMSSALESVTV HHHHHHHHHHHHCCC | 27.77 | 28555341 | |
63 | Ubiquitination | HRMSSALESVTVSDR HHHHHHHHHCCCCCC | 42.77 | 32015554 | |
64 | Phosphorylation | RMSSALESVTVSDRP HHHHHHHHCCCCCCC | 24.76 | 28842319 | |
72 | Ubiquitination | VTVSDRPLGVSITKA CCCCCCCCCEEEEEC | 12.62 | 29967540 | |
78 | Ubiquitination | PLGVSITKAEVAPEE CCCEEEEECCCCCHH | 40.66 | 32015554 | |
78 | Sumoylation | PLGVSITKAEVAPEE CCCEEEEECCCCCHH | 40.66 | 28112733 | |
79 | Ubiquitination | LGVSITKAEVAPEED CCEEEEECCCCCHHH | 14.08 | 32015554 | |
118 | Ubiquitination | TECLQKESEKLESVN HHHHHHHHHHHHHHC | 47.25 | 22817900 | |
120 | Ubiquitination | CLQKESEKLESVNAE HHHHHHHHHHHHCHH | 67.82 | 32015554 | |
129 | Ubiquitination | ESVNAELKAQIEELK HHHCHHHHHHHHHHH | 29.74 | 29967540 | |
136 | Ubiquitination | KAQIEELKNEKQHLI HHHHHHHHHHHHHHH | 67.36 | 32015554 | |
162 | Phosphorylation | VRAQNGRTPEDERNL EECCCCCCCHHHHHH | 32.21 | 27794612 | |
175 | Ubiquitination | NLFIQQIKEGTLQS- HHHHHHHHHCCCCC- | 45.83 | 22817900 | |
175 | Sumoylation | NLFIQQIKEGTLQS- HHHHHHHHHCCCCC- | 45.83 | 28112733 | |
175 (in isoform 1) | Ubiquitination | - | 45.83 | 21906983 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATF3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATF3_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00852 | Pseudoephedrine |
loading...