UniProt ID | CEBPG_HUMAN | |
---|---|---|
UniProt AC | P53567 | |
Protein Name | CCAAT/enhancer-binding protein gamma | |
Gene Name | CEBPG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. [PubMed: 7665092 Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.] | |
Protein Sequence | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Sumoylation | -----MSKISQQNST -----CCCCCCCCCC | 45.11 | 28112733 | |
9 | Phosphorylation | SKISQQNSTPGVNGI CCCCCCCCCCCCCCE | 31.47 | 25627689 | |
21 | Phosphorylation | NGISVIHTQAHASGL CCEEEEECCCCCCCC | 19.14 | 24247654 | |
44 | Acetylation | AGPGGGGKAVAPSKQ CCCCCCCCCCCCCCC | 42.85 | 26051181 | |
55 | Phosphorylation | PSKQSKKSSPMDRNS CCCCCCCCCCCCCCH | 43.33 | 25627689 | |
56 | Phosphorylation | SKQSKKSSPMDRNSD CCCCCCCCCCCCCHH | 32.88 | 25627689 | |
60 | Methylation | KKSSPMDRNSDEYRQ CCCCCCCCCHHHHHH | 38.00 | - | |
62 | Phosphorylation | SSPMDRNSDEYRQRR CCCCCCCHHHHHHHH | 32.48 | 25159151 | |
86 | Ubiquitination | SRLKSKQKAQDTLQR HHHHHHHHHHHHHHH | 52.32 | 29967540 | |
98 | Ubiquitination | LQRVNQLKEENERLE HHHHHHHHHHHHHHH | 53.90 | 33845483 | |
107 | Ubiquitination | ENERLEAKIKLLTKE HHHHHHHHHHHHHHH | 30.88 | 23000965 | |
109 | Ubiquitination | ERLEAKIKLLTKELS HHHHHHHHHHHHHHH | 36.42 | 23000965 | |
113 | Ubiquitination | AKIKLLTKELSVLKD HHHHHHHHHHHHHHH | 57.54 | 23000965 | |
119 | Ubiquitination | TKELSVLKDLFLEHA HHHHHHHHHHHHHHH | 50.67 | 23000965 | |
135 | Phosphorylation | NLADNVQSISTENTT HHHHHHHHCCCCCCC | 17.77 | 28450419 | |
137 | Phosphorylation | ADNVQSISTENTTAD HHHHHHCCCCCCCCC | 34.61 | 28450419 | |
138 | Phosphorylation | DNVQSISTENTTADG HHHHHCCCCCCCCCC | 31.42 | 28450419 | |
141 | Phosphorylation | QSISTENTTADGDNA HHCCCCCCCCCCCCC | 19.68 | 28450419 | |
142 | Phosphorylation | SISTENTTADGDNAG HCCCCCCCCCCCCCC | 34.04 | 28450419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEBPG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEBPG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEBPG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AF17_HUMAN | MLLT6 | physical | 16189514 | |
MYZAP_HUMAN | POLR2M | physical | 16189514 | |
GRL1A_HUMAN | POLR2M | physical | 16189514 | |
GL1AD_HUMAN | POLR2M | physical | 16189514 | |
DDIT3_HUMAN | DDIT3 | physical | 16189514 | |
DDIT3_HUMAN | DDIT3 | physical | 12618752 | |
CDK2_HUMAN | CDK2 | physical | 12757710 | |
BATF3_HUMAN | BATF3 | physical | 23661758 | |
BATF2_HUMAN | BATF2 | physical | 23661758 | |
BATF_HUMAN | BATF | physical | 23661758 | |
ATF3_HUMAN | ATF3 | physical | 23661758 | |
UROK_HUMAN | PLAU | physical | 23661758 | |
ATF4_HUMAN | ATF4 | physical | 23661758 | |
FOSL1_HUMAN | FOSL1 | physical | 23661758 | |
FOS_HUMAN | FOS | physical | 23661758 | |
JUN_HUMAN | JUN | physical | 23661758 | |
ATF2_HUMAN | ATF2 | physical | 23661758 | |
CREB3_HUMAN | CREB3 | physical | 23661758 | |
CEBPE_HUMAN | CEBPE | physical | 23661758 | |
CEBPA_HUMAN | CEBPA | physical | 23661758 | |
CEBPG_HUMAN | CEBPG | physical | 23661758 | |
DDIT3_HUMAN | DDIT3 | physical | 25416956 | |
KLF5_HUMAN | KLF5 | physical | 16054042 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...