BATF2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BATF2_HUMAN
• UniProt AC: Q8N1L9
• Protein Name: Basic leucine zipper transcriptional factor ATF-like 2
• Gene Name: BATF2
• Organism: Homo sapiens (Human).
• Sequence Length: 274
• Subcellular Localization: Nucleus .
• Protein Description: AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes (By similarity). Selectively suppresses CYR61/CCN1 transcription and hence blocks the downstream cell proliferation signals produced by CYR61 and inhibits CYR61-induced anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma. Possibly acts by interfering with AP-1 binding to CYR61 promoter..
• Protein Sequence: MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	ALHQQHESLEKDNLA HHHHHHHHHHHHCHH	39.44	29414761
200	Phosphorylation	SALQPSLTAQTAPPQ HHCCCCCCCCCCCCC	22.51	22210691
203	Phosphorylation	QPSLTAQTAPPQPLE CCCCCCCCCCCCCCC	38.37	22210691
215	Phosphorylation	PLELEHPTRGKLGSS CCCCCCCCCCCCCCC	54.70	22210691
222	Phosphorylation	TRGKLGSSPDNPSSA CCCCCCCCCCCHHHH	34.18	18785766
227	Phosphorylation	GSSPDNPSSALGLAR CCCCCCHHHHHHHHH	34.20	-
228	Phosphorylation	SSPDNPSSALGLARL CCCCCHHHHHHHHHH	28.86	18785766

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BATF2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BATF2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BATF2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DAZP2_HUMAN	DAZAP2	physical	19060904
MAFF_HUMAN	MAFF	physical	23661758
ATF4_HUMAN	ATF4	physical	23661758
JUNB_HUMAN	JUNB	physical	23661758
JUN_HUMAN	JUN	physical	23661758
CEBPA_HUMAN	CEBPA	physical	23661758
CEBPG_HUMAN	CEBPG	physical	23661758
DDIT3_HUMAN	DDIT3	physical	23661758
1C07_HUMAN	HLA-C	physical	21988832
DEDD_HUMAN	DEDD	physical	21988832
KAT2A_HUMAN	KAT2A	physical	21988832
JUNB_HUMAN	JUNB	physical	21988832
TF65_HUMAN	RELA	physical	21988832
SMAKA_HUMAN	C2orf88	physical	21988832

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.