UniProt ID | SMAKA_HUMAN | |
---|---|---|
UniProt AC | Q9BSF0 | |
Protein Name | Small membrane A-kinase anchor protein | |
Gene Name | C2orf88 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 95 | |
Subcellular Localization | Cell membrane . The GFP-tagged protein has been detected at the plasma membrane, enriched in filopodia and cell-cell junctions. | |
Protein Description | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.. | |
Protein Sequence | MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGCMKSKQT ------CCCCCCCCC | 23115245 | ||
3 | S-palmitoylation | -----MGCMKSKQTF -----CCCCCCCCCC | 23115245 | ||
24 | Phosphorylation | EGEKQHESEEPFMPE CCCCCCCCCCCCCCH | 28270605 | ||
40 | Phosphorylation | RCLPRMASPVNVKEE HCCCCCCCCCCCCHH | 25262027 | ||
66 | Phosphorylation | LEYAHRLSQDILCDA HHHHHHHCHHHHHHH | - | ||
84 | Phosphorylation | WACNNIKYHDIPYIE HHHCCCCHHCCCCCC | 22817900 | ||
89 | Phosphorylation | IKYHDIPYIESEGP- CCHHCCCCCCCCCC- | 24927040 | ||
92 | Phosphorylation | HDIPYIESEGP---- HCCCCCCCCCC---- | 23115245 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
66 | S | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
3 | C | Palmitoylation |
| 23115245 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMAKA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RGPS1_HUMAN | RALGPS1 | physical | 21988832 | |
TYDP2_HUMAN | TDP2 | physical | 21988832 | |
IKBL1_HUMAN | NFKBIL1 | physical | 21988832 | |
MYOD1_HUMAN | MYOD1 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...