UniProt ID | GL1AD_HUMAN | |
---|---|---|
UniProt AC | Q6EEV4 | |
Protein Name | DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 | |
Gene Name | POLR2M | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFGGAAGNVEAPGETFAQRVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVLRASGRRACCGRAVPLPGQKIHLQIARQR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MATPARAPES -----CCCCCCCCCC | 19.04 | 26074081 | |
3 (in isoform 2) | Phosphorylation | - | 19.04 | 26074081 | |
10 | Phosphorylation | TPARAPESPPSADPA CCCCCCCCCCCCCCC | 40.84 | 23401153 | |
10 (in isoform 2) | Phosphorylation | - | 40.84 | 23401153 | |
13 | Phosphorylation | RAPESPPSADPALVA CCCCCCCCCCCCCEE | 49.00 | 25159151 | |
13 (in isoform 2) | Phosphorylation | - | 49.00 | 25159151 | |
45 | Methylation | QNVLAAPRLRAPSSR CCCCCCCCCCCCCCC | 31.89 | 80702223 | |
50 | Phosphorylation | APRLRAPSSRGLGAA CCCCCCCCCCCCCCH | 31.51 | 30576142 | |
50 (in isoform 2) | Phosphorylation | - | 31.51 | 30576142 | |
51 | Phosphorylation | PRLRAPSSRGLGAAE CCCCCCCCCCCCCHH | 29.34 | 26699800 | |
51 (in isoform 2) | Phosphorylation | - | 29.34 | 26699800 | |
93 | Phosphorylation | PGSFSSSSLGAPLPS CCCCCCCCCCCCCCC | 32.54 | 30576142 | |
100 | Phosphorylation | SLGAPLPSRTLFPSL CCCCCCCCCCCCCCC | 45.65 | 30576142 | |
113 | Phosphorylation | SLEGDFDSVTFASVL CCCCCCCHHHHHHHH | 24.05 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GL1AD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GL1AD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GL1AD_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...