AHSP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AHSP_HUMAN
• UniProt AC: Q9NZD4
• Protein Name: Alpha-hemoglobin-stabilizing protein
• Gene Name: AHSP
• Organism: Homo sapiens (Human).
• Sequence Length: 102
• Subcellular Localization: Cytoplasm .
• Protein Description: Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia..
• Protein Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
96	Phosphorylation	LKSHELPSHPPPSS- HHHCCCCCCCCCCC-	62.34	23186163
101	Phosphorylation	LPSHPPPSS------ CCCCCCCCC------	55.22	23186163
102	Phosphorylation	PSHPPPSS------- CCCCCCCC-------	50.44	23186163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AHSP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AHSP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AHSP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZC12A_HUMAN	ZC3H12A	physical	16189514
TM165_HUMAN	TMEM165	physical	21988832
ZC12A_HUMAN	ZC3H12A	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.