UniProt ID | GPN2_HUMAN | |
---|---|---|
UniProt AC | Q9H9Y4 | |
Protein Name | GPN-loop GTPase 2 {ECO:0000305} | |
Gene Name | GPN2 {ECO:0000303|PubMed:20864038, ECO:0000312|HGNC:HGNC:25513} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 310 | |
Subcellular Localization | ||
Protein Description | Small GTPase required for proper localization of RNA polymerase II and III (RNAPII and RNAPIII). May act at an RNAP assembly step prior to nuclear import.. | |
Protein Sequence | MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGAAPTTA ------CCCCCCCCC | 19.14 | 22223895 | |
146 | Phosphorylation | TAVHLVDSHYCTDPA HHHHHHCHHCCCCHH | 14.63 | 30576142 | |
186 | Phosphorylation | KMDLIEHYGKLAFNL HHHHHHHHHHHHHCC | 11.81 | 30257219 | |
299 | Phosphorylation | QEKYLAPSNQSVEQE CCHHCCCCCCCHHHH | 41.72 | 25627689 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPN2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPN2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPN2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
RPB2_HUMAN | POLR2B | physical | 26186194 | |
GPN1_HUMAN | GPN1 | physical | 26186194 | |
RPB11_HUMAN | POLR2J | physical | 26186194 | |
TBA3C_HUMAN | TUBA3C | physical | 26186194 | |
RPAP1_HUMAN | RPAP1 | physical | 26186194 | |
RPAB5_HUMAN | POLR2L | physical | 26186194 | |
RPB11_HUMAN | POLR2J | physical | 28514442 | |
RPAP1_HUMAN | RPAP1 | physical | 28514442 | |
TBA3C_HUMAN | TUBA3C | physical | 28514442 | |
RPAB5_HUMAN | POLR2L | physical | 28514442 | |
GPN1_HUMAN | GPN1 | physical | 28514442 | |
RPB2_HUMAN | POLR2B | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...