PDX1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PDX1_HUMAN
• UniProt AC: P52945
• Protein Name: Pancreas/duodenum homeobox protein 1
• Gene Name: PDX1
• Organism: Homo sapiens (Human).
• Sequence Length: 283
• Subcellular Localization: Nucleus. Cytoplasm, cytosol.
• Protein Description: Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell..
• Protein Sequence: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MNGEEQYYAATQLY -CCHHHHHHHHHHHH	9.80	23663014
8	Phosphorylation	MNGEEQYYAATQLYK CCHHHHHHHHHHHHC	6.88	23663014
11	Phosphorylation	EEQYYAATQLYKDPC HHHHHHHHHHHCCCC	15.78	23663014
14	Phosphorylation	YYAATQLYKDPCAFQ HHHHHHHHCCCCCHH	11.97	23663014
29	Phosphorylation	RGPAPEFSASPPACL CCCCCCCCCCCCCEE	26.61	26074081
31	Phosphorylation	PAPEFSASPPACLYM CCCCCCCCCCCEEEC	30.16	26074081
37	Phosphorylation	ASPPACLYMGRQPPP CCCCCEEECCCCCCC	9.45	26074081
61	Phosphorylation	LGALEQGSPPDISPY HHHHHCCCCCCCCCC	32.71	22817900
66	Phosphorylation	QGSPPDISPYEVPPL CCCCCCCCCCCCCCC	28.89	22817900
151	Phosphorylation	EENKRTRTAYTRAQL HHCCCCCHHHHHHHH	24.33	-
186	Phosphorylation	LAVMLNLTERHIKIW HHHHHHCCHHHHHHH	29.87	28555341
266	Phosphorylation	GRLPPGLSASPQPSS CCCCCCCCCCCCCCC	32.39	26657352
268	Phosphorylation	LPPGLSASPQPSSVA CCCCCCCCCCCCCCC	22.23	20637728
272	Phosphorylation	LSASPQPSSVAPRRP CCCCCCCCCCCCCCC	32.00	23828894
273	Phosphorylation	SASPQPSSVAPRRPQ CCCCCCCCCCCCCCC	29.05	23312004

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
11	T	Phosphorylation	Kinase	PRKDC	P78527	GPS
61	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
61	S	Phosphorylation	Kinase	MAPK9	P45984	GPS
61	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
66	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
66	S	Phosphorylation	Kinase	MAPK9	P45984	GPS
66	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
151	T	Phosphorylation	Kinase	PASK	Q96RG2	Uniprot
268	S	Phosphorylation	Kinase	HIPK2	Q9H2X6	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
268	S	Phosphorylation	Phosphorylated by HIPK2 on Ser-268 upon glucose accumulation.	20637728

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PDX1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
XRCC6_HUMAN	XRCC6	physical	16166097
XRCC5_HUMAN	XRCC5	physical	16166097
PCIF1_HUMAN	PCIF1	physical	15121856
MK14_HUMAN	MAPK14	physical	23331010
PCIF1_HUMAN	PCIF1	physical	28036027

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 260370: Pancreatic agenesis 1 (PAGEN1)
• 125853: Diabetes mellitus, non-insulin-dependent (NIDDM)
• 606392: Maturity-onset diabetes of the young 4 (MODY4)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Pancreatic and duodenal homeobox 1 (PDX1) phosphorylation at serine-269 is HIPK2-dependent and affects PDX1 subnuclear localization.";
An R., da Silva Xavier G., Semplici F., Vakhshouri S., Hao H.X.,Rutter J., Pagano M.A., Meggio F., Pinna L.A., Rutter G.A.;
Biochem. Biophys. Res. Commun. 399:155-161(2010).
Cited for: PHOSPHORYLATION AT SER-268 BY HIPK2.
PubMed: 20637728