TM14A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM14A_HUMAN
• UniProt AC: Q9Y6G1
• Protein Name: Transmembrane protein 14A
• Gene Name: TMEM14A
• Organism: Homo sapiens (Human).
• Sequence Length: 99
• Subcellular Localization: Mitochondrion membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane .
• Protein Description: Inhibits apoptosis via negative regulation of the mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway..
• Protein Sequence: MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
47	Phosphorylation	GYGAYRVSNDKRDVK HCCCHHHCCCCCCCH	30.25	-
87	Phosphorylation	AGLVAGLSLMMILRL HHHHHHHHHHHHHHH	17.19	24114839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM14A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM14A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM14A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LXN_HUMAN	LXN	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.