| UniProt ID | LXN_HUMAN | |
|---|---|---|
| UniProt AC | Q9BS40 | |
| Protein Name | Latexin | |
| Gene Name | LXN | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 222 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation.. | |
| Protein Sequence | MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Phosphorylation | AALVAQNYINYQQGT HHHHHHHHCCCCCCC | 4.39 | 21253578 | |
| 36 | Ubiquitination | HRVFEVQKVKQASME CCEEEEEEEEEECHH | 57.48 | 29967540 | |
| 38 | 2-Hydroxyisobutyrylation | VFEVQKVKQASMEDI EEEEEEEEEECHHCC | 47.37 | - | |
| 38 | Malonylation | VFEVQKVKQASMEDI EEEEEEEEEECHHCC | 47.37 | 26320211 | |
| 41 | Phosphorylation | VQKVKQASMEDIPGR EEEEEEECHHCCCCC | 21.88 | 25849741 | |
| 42 | Sulfoxidation | QKVKQASMEDIPGRG EEEEEECHHCCCCCC | 6.34 | 30846556 | |
| 51 | Ubiquitination | DIPGRGHKYHLKFAV CCCCCCHHHHHHHHH | 36.87 | 29967540 | |
| 55 | Acetylation | RGHKYHLKFAVEEII CCHHHHHHHHHHHHH | 20.26 | 19413330 | |
| 162 | 2-Hydroxyisobutyrylation | DTWYKMVKIQTVKQV CHHHEEEEEEEEEEE | 26.12 | - | |
| 167 | Acetylation | MVKIQTVKQVQRNDD EEEEEEEEEECCCCC | 48.41 | 27452117 | |
| 213 | Phosphorylation | GTKVKHNSRLPKEVQ CCCCCCCCCCCCCCC | 34.61 | 24702127 | |
| 217 | Ubiquitination | KHNSRLPKEVQLE-- CCCCCCCCCCCCC-- | 75.10 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LXN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LXN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LXN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CE162_HUMAN | CEP162 | physical | 17353931 | |
| TR150_HUMAN | THRAP3 | physical | 17353931 | |
| PPM1A_HUMAN | PPM1A | physical | 17353931 | |
| CIRBP_HUMAN | CIRBP | physical | 17353931 | |
| CLAP2_HUMAN | CLASP2 | physical | 17353931 | |
| SH3L1_HUMAN | SH3BGRL | physical | 22939629 | |
| GSG1L_HUMAN | GSG1L | physical | 25416956 | |
| ZKSC4_HUMAN | ZKSCAN4 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
