ADTRP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADTRP_HUMAN
• UniProt AC: Q96IZ2
• Protein Name: Androgen-dependent TFPI-regulating protein
• Gene Name: ADTRP
• Organism: Homo sapiens (Human).
• Sequence Length: 230
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Colocalized with TFPI and CAV1 in lipid rafts.
• Protein Description: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro)..
• Protein Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	LLLQTIFYGVTCLDD HHHHHHHHCCHHHHH	13.56	50558201
61	Phosphorylation	QTIFYGVTCLDDVLK HHHHHCCHHHHHHHH	11.73	50558207

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADTRP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADTRP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADTRP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VTNC_HUMAN	VTN	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.