| UniProt ID | S35C2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NQQ7 | |
| Protein Name | Solute carrier family 35 member C2 | |
| Gene Name | SLC35C2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 365 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . Golgi apparatus, cis-Golgi network membrane . Endoplasmic reticulum-Golgi intermediate compartment membrane . |
|
| Protein Description | May play an important role in the cellular response to tissue hypoxia. May be either a GDP-fucose transporter that competes with SLC35C1 for GDP-fucose, or a factor that otherwise enhances the fucosylation of Notch and is required for optimal Notch signaling in mammalian cells.. | |
| Protein Sequence | MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQMLLQKAELGLQNPIDTMFHLQPLMFLGLFPLFAVFEGLHLSTSEKIFRFQDTGLLLRVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 101 | Phosphorylation | TALDVGLSNWSFLYV HHHHHCCCCCCCEEE | 30.26 | 24719451 | |
| 102 | N-linked_Glycosylation | ALDVGLSNWSFLYVT HHHHCCCCCCCEEEE | 43.37 | UniProtKB CARBOHYD | |
| 104 | Phosphorylation | DVGLSNWSFLYVTVS HHCCCCCCCEEEEHH | 15.04 | 24719451 | |
| 107 | Phosphorylation | LSNWSFLYVTVSLYT CCCCCCEEEEHHHHH | 7.65 | 24719451 | |
| 118 | Phosphorylation | SLYTMTKSSAVLFIL HHHHCCHHHHHHHHH | 17.86 | - | |
| 119 | Phosphorylation | LYTMTKSSAVLFILI HHHCCHHHHHHHHHH | 24.77 | - | |
| 155 | Phosphorylation | AGGLFMFTYKSTQFN HCCHHHHEECCCCCC | 20.46 | 20068231 | |
| 156 | Phosphorylation | GGLFMFTYKSTQFNV CCHHHHEECCCCCCC | 7.53 | 20068231 | |
| 265 | Phosphorylation | FSEFLLVSRTSSLTL CCHHHHHHCCCCCHH | 29.79 | 24719451 | |
| 310 (in isoform 2) | Ubiquitination | - | 3.39 | 21890473 | |
| 314 (in isoform 2) | Phosphorylation | - | 8.94 | - | |
| 315 (in isoform 2) | Phosphorylation | - | 7.81 | - | |
| 331 | Ubiquitination | DGGPKALKGLGSSPD CCCCHHHCCCCCCCC | 57.88 | 21890473 | |
| 331 | Ubiquitination | DGGPKALKGLGSSPD CCCCHHHCCCCCCCC | 57.88 | 21890473 | |
| 335 | Phosphorylation | KALKGLGSSPDLELL HHHCCCCCCCCHHHH | 43.68 | 29255136 | |
| 336 | Phosphorylation | ALKGLGSSPDLELLL HHCCCCCCCCHHHHH | 22.19 | 29255136 | |
| 345 | Phosphorylation | DLELLLRSSQREEGD CHHHHHHHHCCCCCC | 30.69 | 23186163 | |
| 346 | Phosphorylation | LELLLRSSQREEGDN HHHHHHHHCCCCCCC | 27.16 | 23186163 | |
| 358 | Phosphorylation | GDNEEEEYFVAQGQQ CCCHHHHCHHHCCCC | 13.46 | - | |
| 360 | Ubiquitination | NEEEEYFVAQGQQ-- CHHHHCHHHCCCC-- | 3.68 | 21890473 | |
| 360 (in isoform 1) | Ubiquitination | - | 3.68 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35C2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35C2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35C2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S35C2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-335, AND MASSSPECTROMETRY. | |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-335, AND MASSSPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-335, AND MASSSPECTROMETRY. | |
