UniProt ID | APH1A_HUMAN | |
---|---|---|
UniProt AC | Q96BI3 | |
Protein Name | Gamma-secretase subunit APH-1A | |
Gene Name | APH1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 265 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus, Golgi stack membrane Multi-pass membrane protein . Predominantly located in the endoplasmic reticulum and in the cis-Golgi. |
|
Protein Description | Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). [PubMed: 12297508] | |
Protein Sequence | MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | Ubiquitination | VFRFAYYKLLKKADE HHHHHHHHHHHHHHH | 34.37 | - | |
95 | Ubiquitination | FAYYKLLKKADEGLA HHHHHHHHHHHHHHH | 57.25 | - | |
96 | Ubiquitination | AYYKLLKKADEGLAS HHHHHHHHHHHHHHH | 62.12 | - | |
96 (in isoform 2) | Ubiquitination | - | 62.12 | - | |
110 | Phosphorylation | SLSEDGRSPISIRQM HCCCCCCCCCCHHHH | 31.92 | 24719451 | |
113 | Phosphorylation | EDGRSPISIRQMAYV CCCCCCCCHHHHHHH | 18.33 | 29142712 | |
182 | S-palmitoylation | GVVFFDACERRRYWA HHHHHHHHHHHHHHH | 4.50 | 19028695 | |
238 | Phosphorylation | TAGGSLRSIQRSLLC HCCCCHHHHHHHHHH | 28.50 | 23898821 | |
242 | Phosphorylation | SLRSIQRSLLCRRQE CHHHHHHHHHHCCCC | 14.87 | 23898821 | |
245 | S-palmitoylation | SIQRSLLCRRQEDSR HHHHHHHHCCCCCCC | 4.01 | 19028695 | |
256 | Phosphorylation | EDSRVMVYSALRIPP CCCCEEEEEEEECCC | 3.10 | 21945579 | |
257 | Phosphorylation | DSRVMVYSALRIPPE CCCEEEEEEEECCCC | 14.93 | 21945579 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APH1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APH1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APH1A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...