UniProt ID | PEN2_HUMAN | |
---|---|---|
UniProt AC | Q9NZ42 | |
Protein Name | Gamma-secretase subunit PEN-2 | |
Gene Name | PSENEN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus, Golgi stack membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . Membrane Multi-pass membrane protein . Predominantly located in the e |
|
Protein Description | Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). [PubMed: 12522139] | |
Protein Sequence | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | ERVSNEEKLNLCRKY HHCCHHHHHHHHHHH | 36.17 | 33845483 | |
60 | Phosphorylation | IKGYVWRSAVGFLFW CCHHHHHHHHHHHHH | 16.17 | 28270605 | |
72 | Phosphorylation | LFWVIVLTSWITIFQ HHHHHHHHHHHHHHH | 15.89 | 28270605 | |
73 | Phosphorylation | FWVIVLTSWITIFQI HHHHHHHHHHHHHHH | 16.60 | 28270605 | |
76 | Phosphorylation | IVLTSWITIFQIYRP HHHHHHHHHHHHHCC | 14.96 | 28270605 | |
81 | Phosphorylation | WITIFQIYRPRWGAL HHHHHHHHCCCCCCC | 12.09 | 28270605 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEN2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEN2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEN2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NICA_HUMAN | NCSTN | physical | 14572442 | |
APH1A_HUMAN | APH1A | physical | 14572442 | |
PSN1_HUMAN | PSEN1 | physical | 14572442 | |
PSN1_HUMAN | PSEN1 | physical | 12198112 | |
PSN2_HUMAN | PSEN2 | physical | 12198112 | |
NICA_HUMAN | NCSTN | physical | 12198112 | |
TRBM_HUMAN | THBD | physical | 21988832 | |
ERLN2_HUMAN | ERLIN2 | physical | 22771797 | |
APH1A_HUMAN | APH1A | physical | 22074918 | |
NICA_HUMAN | NCSTN | physical | 22074918 | |
PSN1_HUMAN | PSEN1 | physical | 22074918 | |
PSN2_HUMAN | PSEN2 | physical | 22074918 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...