PEN2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PEN2_HUMAN
• UniProt AC: Q9NZ42
• Protein Name: Gamma-secretase subunit PEN-2
• Gene Name: PSENEN
• Organism: Homo sapiens (Human).
• Sequence Length: 101
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Golgi apparatus, Golgi stack membrane ; Multi-pass membrane protein . Cell membrane ; Multi-pass membrane protein . Membrane ; Multi-pass membrane protein . Predominantly located in the e
• Protein Description: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). [PubMed: 12522139]
• Protein Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Ubiquitination	ERVSNEEKLNLCRKY HHCCHHHHHHHHHHH	36.17	33845483
60	Phosphorylation	IKGYVWRSAVGFLFW CCHHHHHHHHHHHHH	16.17	28270605
72	Phosphorylation	LFWVIVLTSWITIFQ HHHHHHHHHHHHHHH	15.89	28270605
73	Phosphorylation	FWVIVLTSWITIFQI HHHHHHHHHHHHHHH	16.60	28270605
76	Phosphorylation	IVLTSWITIFQIYRP HHHHHHHHHHHHHCC	14.96	28270605
81	Phosphorylation	WITIFQIYRPRWGAL HHHHHHHHCCCCCCC	12.09	28270605

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PEN2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PEN2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PEN2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NICA_HUMAN	NCSTN	physical	14572442
APH1A_HUMAN	APH1A	physical	14572442
PSN1_HUMAN	PSEN1	physical	14572442
PSN1_HUMAN	PSEN1	physical	12198112
PSN2_HUMAN	PSEN2	physical	12198112
NICA_HUMAN	NCSTN	physical	12198112
TRBM_HUMAN	THBD	physical	21988832
ERLN2_HUMAN	ERLIN2	physical	22771797
APH1A_HUMAN	APH1A	physical	22074918
NICA_HUMAN	NCSTN	physical	22074918
PSN1_HUMAN	PSEN1	physical	22074918
PSN2_HUMAN	PSEN2	physical	22074918

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.