FXYD6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXYD6_HUMAN
• UniProt AC: Q9H0Q3
• Protein Name: FXYD domain-containing ion transport regulator 6
• Gene Name: FXYD6
• Organism: Homo sapiens (Human).
• Sequence Length: 95
• Subcellular Localization: Membrane ; Single-pass type I membrane protein .
• Protein Sequence: MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	MDPFHYDYQTLRIGG CCCCCCCHHHHHHHH	9.02	-
92	Ubiquitination	ANATEPQKAEN---- CCCCCCCCCCC----	69.27	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FXYD6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXYD6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXYD6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HAUS2_HUMAN	HAUS2	physical	16169070
CC90B_HUMAN	CCDC90B	physical	16169070
TRI27_HUMAN	TRIM27	physical	16169070
S35E1_HUMAN	SLC35E1	physical	16169070
RBM48_HUMAN	RBM48	physical	16169070
GDF9_HUMAN	GDF9	physical	16169070
TLE1_HUMAN	TLE1	physical	16169070
P53_HUMAN	TP53	physical	16169070
U119A_HUMAN	UNC119	physical	16169070
CR3L1_HUMAN	CREB3L1	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 603342: Schizophrenia 2 (SCZD2)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.