| UniProt ID | HAUS2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVX0 | |
| Protein Name | HAUS augmin-like complex subunit 2 | |
| Gene Name | HAUS2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 235 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . Localizes to interphase centrosomes and to mitotic spindle microtubules. | |
| Protein Description | Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.. | |
| Protein Sequence | MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | NQEMLNMSKKTVSCF CHHHHCCCCCHHHHE | 29.90 | - | |
| 39 | Ubiquitination | EMLNMSKKTVSCFVN HHHCCCCCHHHHEEC | 47.02 | - | |
| 40 (in isoform 2) | Ubiquitination | - | 22.76 | 21906983 | |
| 63 | Ubiquitination | IQAEIYQKNLEIELL HHHHHHHHCHHHEEE | 46.67 | 21906983 | |
| 63 (in isoform 1) | Ubiquitination | - | 46.67 | 21906983 | |
| 71 (in isoform 1) | Ubiquitination | - | 68.19 | 21906983 | |
| 71 | Ubiquitination | NLEIELLKLEKDTAD CHHHEEEECCCCCCC | 68.19 | 21906983 | |
| 74 | Ubiquitination | IELLKLEKDTADVVH HEEEECCCCCCCCCC | 71.47 | - | |
| 88 | Ubiquitination | HPFFLAQKCHTLQSM CHHHHHHHHHHHHHH | 23.52 | - | |
| 104 | Ubiquitination | NHLEAVLKEKRSLRQ HHHHHHHHHHHHHHH | 55.37 | - | |
| 115 | Ubiquitination | SLRQRLLKPMCQENL HHHHHHHHHHHHCCC | 34.98 | - | |
| 164 | Acetylation | PHLAANLKKMNQALA HHHHHHHHHHHHHHH | 50.19 | 25953088 | |
| 182 (in isoform 2) | Ubiquitination | - | 61.78 | 21906983 | |
| 192 | Ubiquitination | ENILKWRKQQNEVSS HHHHHHHHHHHHHHH | 55.94 | - | |
| 203 | Ubiquitination | EVSSCIPKILAEESY HHHHHHHHHHHHCCH | 30.36 | - | |
| 209 | Phosphorylation | PKILAEESYLYKHDI HHHHHHCCHHHCCCC | 16.37 | 28555341 | |
| 210 | Phosphorylation | KILAEESYLYKHDII HHHHHCCHHHCCCCC | 19.82 | 25159151 | |
| 213 | Ubiquitination | AEESYLYKHDIIMPP HHCCHHHCCCCCCCC | 32.00 | 2190698 | |
| 213 (in isoform 1) | Ubiquitination | - | 32.00 | 21906983 | |
| 226 | Ubiquitination | PPLPFTSKVHVQTIN CCCCCCCCEEEEEEE | 33.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HAUS2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAUS2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAUS2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
