RT24_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT24_HUMAN
• UniProt AC: Q96EL2
• Protein Name: 28S ribosomal protein S24, mitochondrial
• Gene Name: MRPS24
• Organism: Homo sapiens (Human).
• Sequence Length: 167
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	LLGPRVLSWSRELPC CCCHHHHHHCCCCCC	21.83	22468782
18	Phosphorylation	GPRVLSWSRELPCAW CHHHHHHCCCCCCHH	16.70	22468782
30	Phosphorylation	CAWRALHTSPVCAKN CHHHHHCCCCCHHCC	35.26	30266825
31	Phosphorylation	AWRALHTSPVCAKNR HHHHHCCCCCHHCCC	12.46	30266825
36	Ubiquitination	HTSPVCAKNRAARVR CCCCCHHCCCEEEEE	41.67	29967540
46	Ubiquitination	AARVRVSKGDKPVTY EEEEEECCCCCCCCH	69.17	29967540
49	Ubiquitination	VRVSKGDKPVTYEEA EEECCCCCCCCHHHH	50.48	29967540
66	Ubiquitination	PHYIAHRKGWLSLHT CHHHHHCCCEEEEEC	44.57	29967540
86	Phosphorylation	EDHAAERTVEDVFLR CCCHHHHCHHHHHHH	21.54	29514088
93	Methylation	TVEDVFLRKFMWGTF CHHHHHHHHHHHCCC	20.78	115483819
99	Phosphorylation	LRKFMWGTFPGCLAD HHHHHHCCCCCHHHH	15.90	-
128	Phosphorylation	AVVLRQLSPHKYYFL EEEHHHCCCCCEEEE	19.34	24719451
161	Ubiquitination	HLQTVPSKVVYKYL- EEECCCCHHHHCCC-	29.65	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT24_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT24_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT24_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
MMAD_HUMAN	MMADHC	physical	28514442
RT34_HUMAN	MRPS34	physical	28514442
RT15_HUMAN	MRPS15	physical	28514442
ZZEF1_HUMAN	ZZEF1	physical	28514442
RT27_HUMAN	MRPS27	physical	28514442
ARMC8_HUMAN	ARMC8	physical	28514442
RT31_HUMAN	MRPS31	physical	28514442
RT11_HUMAN	MRPS11	physical	28514442
HECD3_HUMAN	HECTD3	physical	28514442
LONM_HUMAN	LONP1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.