UniProt ID | RT15_HUMAN | |
---|---|---|
UniProt AC | P82914 | |
Protein Name | 28S ribosomal protein S15, mitochondrial | |
Gene Name | MRPS15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 257 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MLRVAWRTLSLIRTR CCHHHHHHHHHHHHH | 15.25 | 24043423 | |
10 | Phosphorylation | RVAWRTLSLIRTRAV HHHHHHHHHHHHHCC | 22.57 | 23898821 | |
74 | Ubiquitination | PPPSTLLKDYQNVPG CCCCHHCHHHCCCCC | 58.46 | 22817900 | |
84 | Ubiquitination | QNVPGIEKVDDVVKR CCCCCCCCHHHHHHH | 49.39 | 29967540 | |
100 | 2-Hydroxyisobutyrylation | LSLEMANKKEMLKIK HCHHHCCHHHHHHHH | 40.34 | - | |
114 | Ubiquitination | KQEQFMKKIVANPED HHHHHHHHHHCCHHH | 30.53 | 29967540 | |
114 | Malonylation | KQEQFMKKIVANPED HHHHHHHHHHCCHHH | 30.53 | 26320211 | |
133 | Phosphorylation | EARIIALSVKIRSYE HHHHHHHHHHHHHHH | 16.61 | 20068231 | |
145 | Ubiquitination | SYEEHLEKHRKDKAH HHHHHHHHHCCCHHH | 55.88 | 29967540 | |
145 | 2-Hydroxyisobutyrylation | SYEEHLEKHRKDKAH HHHHHHHHHCCCHHH | 55.88 | - | |
189 | Phosphorylation | CWGLGIEYTFPPLYY HHHCCCCCCCCCHHH | 16.26 | 22817900 | |
219 | Ubiquitination | RVFQETQKLKKRRRA HHHHHHHHHHHHHHH | 70.46 | 24816145 | |
228 | Ubiquitination | KKRRRALKAAAAAQK HHHHHHHHHHHHHHH | 34.69 | 29967540 | |
244 | Phosphorylation | AKRRNPDSPAKAIPK HHHHCCCCHHHHCCC | 28.19 | 29214152 | |
254 | Ubiquitination | KAIPKTLKDSQ---- HHCCCCHHCCC---- | 61.64 | 24816145 | |
256 | Phosphorylation | IPKTLKDSQ------ CCCCHHCCC------ | 35.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT31_HUMAN | MRPS31 | physical | 28514442 | |
RT09_HUMAN | MRPS9 | physical | 28514442 | |
MCRS1_HUMAN | MCRS1 | physical | 28514442 | |
RT05_HUMAN | MRPS5 | physical | 28514442 | |
RT21_HUMAN | MRPS21 | physical | 28514442 | |
RT33_HUMAN | MRPS33 | physical | 28514442 | |
RT10_HUMAN | MRPS10 | physical | 28514442 | |
RT26_HUMAN | MRPS26 | physical | 28514442 | |
RT29_HUMAN | DAP3 | physical | 28514442 | |
RT27_HUMAN | MRPS27 | physical | 28514442 | |
NOA1_HUMAN | NOA1 | physical | 28514442 | |
KAPCB_HUMAN | PRKACB | physical | 28514442 | |
RT23_HUMAN | MRPS23 | physical | 28514442 | |
RT14_HUMAN | MRPS14 | physical | 28514442 | |
RT35_HUMAN | MRPS35 | physical | 28514442 | |
PTCD3_HUMAN | PTCD3 | physical | 28514442 | |
RT25_HUMAN | MRPS25 | physical | 28514442 | |
RT06_HUMAN | MRPS6 | physical | 28514442 | |
KAP1_HUMAN | PRKAR1B | physical | 28514442 | |
RT28_HUMAN | MRPS28 | physical | 28514442 | |
ZN579_HUMAN | ZNF579 | physical | 28514442 | |
FABD_HUMAN | MCAT | physical | 28514442 | |
RT22_HUMAN | MRPS22 | physical | 28514442 | |
KAPCG_HUMAN | PRKACG | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...