RT15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT15_HUMAN
• UniProt AC: P82914
• Protein Name: 28S ribosomal protein S15, mitochondrial
• Gene Name: MRPS15
• Organism: Homo sapiens (Human).
• Sequence Length: 257
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MLRVAWRTLSLIRTR CCHHHHHHHHHHHHH	15.25	24043423
10	Phosphorylation	RVAWRTLSLIRTRAV HHHHHHHHHHHHHCC	22.57	23898821
74	Ubiquitination	PPPSTLLKDYQNVPG CCCCHHCHHHCCCCC	58.46	22817900
84	Ubiquitination	QNVPGIEKVDDVVKR CCCCCCCCHHHHHHH	49.39	29967540
100	2-Hydroxyisobutyrylation	LSLEMANKKEMLKIK HCHHHCCHHHHHHHH	40.34	-
114	Ubiquitination	KQEQFMKKIVANPED HHHHHHHHHHCCHHH	30.53	29967540
114	Malonylation	KQEQFMKKIVANPED HHHHHHHHHHCCHHH	30.53	26320211
133	Phosphorylation	EARIIALSVKIRSYE HHHHHHHHHHHHHHH	16.61	20068231
145	Ubiquitination	SYEEHLEKHRKDKAH HHHHHHHHHCCCHHH	55.88	29967540
145	2-Hydroxyisobutyrylation	SYEEHLEKHRKDKAH HHHHHHHHHCCCHHH	55.88	-
189	Phosphorylation	CWGLGIEYTFPPLYY HHHCCCCCCCCCHHH	16.26	22817900
219	Ubiquitination	RVFQETQKLKKRRRA HHHHHHHHHHHHHHH	70.46	24816145
228	Ubiquitination	KKRRRALKAAAAAQK HHHHHHHHHHHHHHH	34.69	29967540
244	Phosphorylation	AKRRNPDSPAKAIPK HHHHCCCCHHHHCCC	28.19	29214152
254	Ubiquitination	KAIPKTLKDSQ---- HHCCCCHHCCC----	61.64	24816145
256	Phosphorylation	IPKTLKDSQ------ CCCCHHCCC------	35.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT15_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT31_HUMAN	MRPS31	physical	28514442
RT09_HUMAN	MRPS9	physical	28514442
MCRS1_HUMAN	MCRS1	physical	28514442
RT05_HUMAN	MRPS5	physical	28514442
RT21_HUMAN	MRPS21	physical	28514442
RT33_HUMAN	MRPS33	physical	28514442
RT10_HUMAN	MRPS10	physical	28514442
RT26_HUMAN	MRPS26	physical	28514442
RT29_HUMAN	DAP3	physical	28514442
RT27_HUMAN	MRPS27	physical	28514442
NOA1_HUMAN	NOA1	physical	28514442
KAPCB_HUMAN	PRKACB	physical	28514442
RT23_HUMAN	MRPS23	physical	28514442
RT14_HUMAN	MRPS14	physical	28514442
RT35_HUMAN	MRPS35	physical	28514442
PTCD3_HUMAN	PTCD3	physical	28514442
RT25_HUMAN	MRPS25	physical	28514442
RT06_HUMAN	MRPS6	physical	28514442
KAP1_HUMAN	PRKAR1B	physical	28514442
RT28_HUMAN	MRPS28	physical	28514442
ZN579_HUMAN	ZNF579	physical	28514442
FABD_HUMAN	MCAT	physical	28514442
RT22_HUMAN	MRPS22	physical	28514442
KAPCG_HUMAN	PRKACG	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.