| UniProt ID | RT25_HUMAN | |
|---|---|---|
| UniProt AC | P82663 | |
| Protein Name | 28S ribosomal protein S25, mitochondrial | |
| Gene Name | MRPS25 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 173 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | PIRRTLQYLSQGNVV CHHHHHHHHHCCCEE | 16.07 | 28152594 | |
| 17 | Phosphorylation | RRTLQYLSQGNVVFK HHHHHHHHCCCEEEE | 30.98 | 28152594 | |
| 58 | Acetylation | NIPQIQYKNPWVQIM ECCCHHCCCCCEEEE | 39.91 | 26051181 | |
| 68 | Acetylation | WVQIMMFKNMTPSPF CEEEEEEECCCCCCC | 28.10 | 26051181 | |
| 71 | Phosphorylation | IMMFKNMTPSPFLRF EEEEECCCCCCCEEE | 29.97 | 20068231 | |
| 73 | Phosphorylation | MFKNMTPSPFLRFYL EEECCCCCCCEEEEE | 21.08 | - | |
| 93 (in isoform 3) | Phosphorylation | - | 38.23 | 22210691 | |
| 100 (in isoform 3) | Phosphorylation | - | 41.65 | 22210691 | |
| 109 (in isoform 3) | Phosphorylation | - | 51.00 | 22210691 | |
| 112 | Phosphorylation | ILGKNEETLREEEEE HHCCCHHHHHHHHHH | 25.57 | 26657352 | |
| 121 | Ubiquitination | REEEEEKKQLSHPAN HHHHHHHHHHCCCCC | 60.80 | 29967540 | |
| 136 (in isoform 2) | Phosphorylation | - | 4.72 | 22798277 | |
| 157 | Ubiquitination | PSLVPLPKEMRGKYK CCCCCCCHHHCCHHH | 72.35 | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT25_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT25_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT25_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RT35_HUMAN | MRPS35 | physical | 22939629 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
