UniProt ID | RT35_HUMAN | |
---|---|---|
UniProt AC | P82673 | |
Protein Name | 28S ribosomal protein S35, mitochondrial | |
Gene Name | MRPS35 {ECO:0000312|HGNC:HGNC:16635} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 323 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | AALPAWLSLQSRART HHHHHHHHHHHHHHH | 17.42 | 27251275 | |
14 | Phosphorylation | PAWLSLQSRARTLRA HHHHHHHHHHHHHHH | 32.95 | 24719451 | |
18 | Phosphorylation | SLQSRARTLRAFSTA HHHHHHHHHHHHHHH | 21.44 | 24719451 | |
36 | Phosphorylation | ATPVPTPSLPERTPG CCCCCCCCCCCCCCC | 60.06 | 27251275 | |
41 | Phosphorylation | TPSLPERTPGNERPP CCCCCCCCCCCCCCC | 33.61 | 27251275 | |
68 | Phosphorylation | AVDQDWPSVYPVAAP CCCCCCCCCCCCCCC | 29.99 | 19835603 | |
70 | Phosphorylation | DQDWPSVYPVAAPFK CCCCCCCCCCCCCCC | 9.05 | 19835603 | |
79 | Phosphorylation | VAAPFKPSAVPLPVR CCCCCCCCCCCCCEE | 42.35 | 19835603 | |
89 | Phosphorylation | PLPVRMGYPVKKGVP CCCEECCCCCCCCCC | 8.77 | 19835603 | |
99 | Ubiquitination | KKGVPMAKEGNLELL CCCCCCCCCCCEEEE | 60.96 | 33845483 | |
115 | Phosphorylation | IPNFLHLTPVAIKKH CCCCHHCHHHHHHHH | 12.64 | 24719451 | |
120 | Acetylation | HLTPVAIKKHCEALK HCHHHHHHHHHHHHH | 27.08 | 25953088 | |
127 | Ubiquitination | KKHCEALKDFCTEWP HHHHHHHHHHHHHCC | 56.67 | 29967540 | |
127 | Acetylation | KKHCEALKDFCTEWP HHHHHHHHHHHHHCC | 56.67 | 26822725 | |
142 | Ubiquitination | AALDSDEKCEKHFPI CCCCCCCHHHHHCCE | 53.32 | 29967540 | |
156 | Phosphorylation | IEIDSTDYVSSGPSV EEECCCCCCCCCCCC | 11.43 | - | |
176 | 2-Hydroxyisobutyrylation | RVVVLRVKLSSLNLD EEEEEEEEHHHCCCC | 35.90 | - | |
187 | 2-Hydroxyisobutyrylation | LNLDDHAKKKLIKLV CCCCHHHHHHHHHHH | 47.20 | - | |
206 | Phosphorylation | CKTTDVLTIKTDRCP CCCCCEEEEECCCCC | 21.92 | - | |
207 (in isoform 2) | Ubiquitination | - | 3.85 | - | |
208 | Acetylation | TTDVLTIKTDRCPLR CCCEEEEECCCCCCC | 38.85 | 25953088 | |
219 | Phosphorylation | CPLRRQNYDYAVYLL CCCCCCCHHHHHHHH | 11.29 | - | |
230 | Phosphorylation | VYLLTVLYHESWNTE HHHHHHHHHHCCCHH | 10.13 | - | |
234 (in isoform 2) | Ubiquitination | - | 16.87 | - | |
238 (in isoform 2) | Ubiquitination | - | 59.92 | - | |
241 | Ubiquitination | WNTEEWEKSKTEADM CCHHHHHHHCCHHHH | 59.32 | 23503661 | |
242 | Phosphorylation | NTEEWEKSKTEADME CHHHHHHHCCHHHHH | 33.04 | 26503514 | |
243 | Ubiquitination | TEEWEKSKTEADMEE HHHHHHHCCHHHHHH | 62.54 | 23503661 | |
251 | Phosphorylation | TEADMEEYIWENSSS CHHHHHHHHCCCCHH | 9.68 | 26503514 | |
256 | Phosphorylation | EEYIWENSSSERNIL HHHHCCCCHHHHHHH | 24.59 | - | |
264 (in isoform 2) | Ubiquitination | - | 33.34 | - | |
265 | Phosphorylation | SERNILETLLQMKAA HHHHHHHHHHHHHHH | 29.35 | 26503514 | |
270 | Ubiquitination | LETLLQMKAAEKNME HHHHHHHHHHHHHCC | 31.33 | 23503661 | |
274 | Ubiquitination | LQMKAAEKNMEINKE HHHHHHHHHCCCCHH | 57.79 | 23503661 | |
276 | Sulfoxidation | MKAAEKNMEINKEEL HHHHHHHCCCCHHHH | 8.95 | 21406390 | |
277 (in isoform 2) | Ubiquitination | - | 53.45 | - | |
280 | Ubiquitination | EKNMEINKEELLGTK HHHCCCCHHHHCCCH | 59.22 | 23503661 | |
294 | Ubiquitination | KEIEEYKKSVVSLKN HHHHHHHHHHHCCCC | 47.80 | 23503661 | |
300 | Ubiquitination | KKSVVSLKNEEENEN HHHHHCCCCHHHCCC | 55.60 | 23503661 | |
313 | Ubiquitination | ENSISQYKESVKRLL CCHHHHHHHHHHHHH | 35.56 | 23503661 | |
317 | Ubiquitination | SQYKESVKRLLNVT- HHHHHHHHHHHCCC- | 46.75 | 23503661 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT35_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT35_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT35_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VATC1_HUMAN | ATP6V1C1 | physical | 22939629 | |
AT1B1_HUMAN | ATP1B1 | physical | 26344197 | |
RT29_HUMAN | DAP3 | physical | 26344197 | |
RT18B_HUMAN | MRPS18B | physical | 26344197 | |
RT23_HUMAN | MRPS23 | physical | 26344197 | |
RT31_HUMAN | MRPS31 | physical | 26344197 | |
RT05_HUMAN | MRPS5 | physical | 26344197 | |
RT07_HUMAN | MRPS7 | physical | 26344197 | |
RT09_HUMAN | MRPS9 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...