UniProt ID | RT18B_HUMAN | |
---|---|---|
UniProt AC | Q9Y676 | |
Protein Name | 28S ribosomal protein S18b, mitochondrial | |
Gene Name | MRPS18B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 258 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAASVLNTVLR ----CHHHHHHHHHH | 20.00 | 29255136 | |
8 | Phosphorylation | MAASVLNTVLRRLPM CHHHHHHHHHHHCHH | 19.43 | 29255136 | |
17 | Phosphorylation | LRRLPMLSLFRGSHR HHHCHHHHHHCCCCE | 21.14 | 29978859 | |
22 | Phosphorylation | MLSLFRGSHRVQVPL HHHHHCCCCEECCCH | 12.12 | - | |
38 | Phosphorylation | TLCTKAPSEEDSLSS HHCCCCCCCCCCCCC | 59.48 | 30266825 | |
42 | Phosphorylation | KAPSEEDSLSSVPIS CCCCCCCCCCCCCCC | 33.17 | 30266825 | |
44 | Phosphorylation | PSEEDSLSSVPISPY CCCCCCCCCCCCCCC | 32.99 | 30266825 | |
45 | Phosphorylation | SEEDSLSSVPISPYK CCCCCCCCCCCCCCC | 36.89 | 30266825 | |
49 | Phosphorylation | SLSSVPISPYKDEPW CCCCCCCCCCCCCCC | 18.99 | 30266825 | |
51 | Phosphorylation | SSVPISPYKDEPWKY CCCCCCCCCCCCCCC | 25.04 | 30266825 | |
52 | Ubiquitination | SVPISPYKDEPWKYL CCCCCCCCCCCCCCC | 60.03 | - | |
58 | Phosphorylation | YKDEPWKYLESEEYQ CCCCCCCCCCCHHHH | 16.31 | 27174698 | |
61 | Phosphorylation | EPWKYLESEEYQERY CCCCCCCCHHHHHHH | 32.88 | 27174698 | |
64 | Phosphorylation | KYLESEEYQERYGSR CCCCCHHHHHHHCCC | 16.18 | 27174698 | |
68 | Phosphorylation | SEEYQERYGSRPVWA CHHHHHHHCCCCCHH | 20.78 | 27174698 | |
70 | Phosphorylation | EYQERYGSRPVWADY HHHHHHCCCCCHHHH | 25.20 | 27174698 | |
99 | Ubiquitination | KTCIRRNKVVGNPCP HHHHHHCCCCCCCCC | 36.16 | - | |
112 | Ubiquitination | CPICRDHKLHVDFRN CCCCCCCCCCEECCC | 44.57 | - | |
112 | Acetylation | CPICRDHKLHVDFRN CCCCCCCCCCEECCC | 44.57 | 25953088 | |
156 | 2-Hydroxyisobutyrylation | RLTQAIQKARDHGLL HHHHHHHHHHHCCCE | 39.00 | - | |
156 | Acetylation | RLTQAIQKARDHGLL HHHHHHHHHHHCCCE | 39.00 | 25953088 | |
156 | Succinylation | RLTQAIQKARDHGLL HHHHHHHHHHHCCCE | 39.00 | 27452117 | |
165 | Phosphorylation | RDHGLLIYHIPQVEP HHCCCEEEECCCCCC | 8.15 | 27642862 | |
200 | Phosphorylation | LVSGDPWYPWYNWKQ CCCCCCCCCCCCCCC | 6.84 | 27642862 | |
203 | Phosphorylation | GDPWYPWYNWKQPPE CCCCCCCCCCCCCCH | 13.47 | 27642862 | |
220 | Phosphorylation | LSRLRRLYQGHLQEE HHHHHHHHHHHCCCC | 15.61 | 27642862 | |
228 | Phosphorylation | QGHLQEESGPPPESM HHHCCCCCCCCCCCC | 56.71 | 28348404 | |
234 | Phosphorylation | ESGPPPESMPKMPPR CCCCCCCCCCCCCCC | 46.27 | 28348404 | |
242 | Phosphorylation | MPKMPPRTPAEASST CCCCCCCCCCCCCCC | 32.40 | 30624053 | |
247 | Phosphorylation | PRTPAEASSTGQTGP CCCCCCCCCCCCCCC | 21.67 | 26471730 | |
248 | Phosphorylation | RTPAEASSTGQTGPQ CCCCCCCCCCCCCCC | 43.54 | 28857561 | |
249 | Phosphorylation | TPAEASSTGQTGPQS CCCCCCCCCCCCCCC | 30.71 | 28857561 | |
252 | Phosphorylation | EASSTGQTGPQSAL- CCCCCCCCCCCCCC- | 52.77 | 26471730 | |
256 | Phosphorylation | TGQTGPQSAL----- CCCCCCCCCC----- | 34.37 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
49 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT18B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT18B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT22_HUMAN | MRPS22 | physical | 22939629 | |
RT25_HUMAN | MRPS25 | physical | 22939629 | |
RT26_HUMAN | MRPS26 | physical | 22939629 | |
RT35_HUMAN | MRPS35 | physical | 22939629 | |
RT28_HUMAN | MRPS28 | physical | 22939629 | |
SYK_HUMAN | KARS | physical | 22939629 | |
SYQ_HUMAN | QARS | physical | 22939629 | |
UBR5_HUMAN | UBR5 | physical | 22939629 | |
EBNA4_EBVB9 | EBNA3B | physical | 18391203 | |
RB_HUMAN | RB1 | physical | 18391203 | |
RT06_HUMAN | MRPS6 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-49, AND MASSSPECTROMETRY. |