UniProt ID | RT06_HUMAN | |
---|---|---|
UniProt AC | P82932 | |
Protein Name | 28S ribosomal protein S6, mitochondrial | |
Gene Name | MRPS6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MPRYELALILK ----CCHHHHHHHHH | 14.93 | - | |
13 | Sulfoxidation | LALILKAMQRPETAA HHHHHHHHCCCCHHH | 3.12 | 21406390 | |
18 | Phosphorylation | KAMQRPETAATLKRT HHHCCCCHHHHHHHH | 25.03 | - | |
23 | 2-Hydroxyisobutyrylation | PETAATLKRTIEALM CCHHHHHHHHHHHHH | 43.04 | - | |
23 | Ubiquitination | PETAATLKRTIEALM CCHHHHHHHHHHHHH | 43.04 | - | |
32 | Methylation | TIEALMDRGAIVRDL HHHHHHHCCCHHHCH | 23.60 | 115483837 | |
95 | Ubiquitination | VIRGNIVKHPLTQEL HHCCCCCCCCCCHHH | 35.39 | 33845483 | |
103 | Ubiquitination | HPLTQELKECEGIVP CCCCHHHHHCCCCCC | 60.61 | 32015554 | |
116 | Ubiquitination | VPVPLAEKLYSTKKR CCCCHHHHHHCCCCC | 47.30 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT06_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT06_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT06_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CE126_HUMAN | KIAA1377 | physical | 16169070 | |
LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
A4_HUMAN | APP | physical | 21832049 | |
RN181_HUMAN | RNF181 | physical | 21988832 | |
SRBP2_HUMAN | SREBF2 | physical | 21988832 | |
STA5A_HUMAN | STAT5A | physical | 21988832 | |
RT18C_HUMAN | MRPS18C | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...