| UniProt ID | RT18C_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y3D5 | |
| Protein Name | 28S ribosomal protein S18c, mitochondrial | |
| Gene Name | MRPS18C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | GLGRKKLTHLVTAAV CCCHHHHHHHHHHHH | 23.26 | - | |
| 21 | Phosphorylation | KKLTHLVTAAVSLTH HHHHHHHHHHHHCCC | 18.43 | 22468782 | |
| 25 | Phosphorylation | HLVTAAVSLTHPGTH HHHHHHHHCCCCCCC | 23.87 | 22468782 | |
| 33 | Phosphorylation | LTHPGTHTVLWRRGC CCCCCCCEEEEECCC | 19.68 | 22468782 | |
| 53 | Phosphorylation | SNEDLPISMENPYKE CCCCCCCCCCCCCCC | 20.36 | 30576142 | |
| 64 | Malonylation | PYKEPLKKCILCGKH CCCCCHHHHHHCCCC | 33.90 | 26320211 | |
| 102 | 2-Hydroxyisobutyrylation | HITGLCGKKQKEITK HHHHCCCHHHHHHHH | 51.54 | - | |
| 105 | Acetylation | GLCGKKQKEITKAIK HCCCHHHHHHHHHHH | 61.02 | 20167786 | |
| 109 | Acetylation | KKQKEITKAIKRAQI HHHHHHHHHHHHHHH | 54.50 | 20167786 | |
| 125 | Acetylation | GFMPVTYKDPAYLKD CEEECEECCHHHHCC | 48.12 | 30590473 | |
| 125 | Ubiquitination | GFMPVTYKDPAYLKD CEEECEECCHHHHCC | 48.12 | 21890473 | |
| 131 | Acetylation | YKDPAYLKDPKVCNI ECCHHHHCCCCCCCC | 60.35 | 23236377 | |
| 131 | Malonylation | YKDPAYLKDPKVCNI ECCHHHHCCCCCCCC | 60.35 | 30639696 | |
| 131 | Succinylation | YKDPAYLKDPKVCNI ECCHHHHCCCCCCCC | 60.35 | 27452117 | |
| 134 | Malonylation | PAYLKDPKVCNIRYR HHHHCCCCCCCCEEC | 70.34 | 26320211 | |
| 134 | Acetylation | PAYLKDPKVCNIRYR HHHHCCCCCCCCEEC | 70.34 | 23236377 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT18C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT18C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT18C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RT18C_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-131, AND MASS SPECTROMETRY. | |
