UniProt ID | RT33_HUMAN | |
---|---|---|
UniProt AC | Q9Y291 | |
Protein Name | 28S ribosomal protein S33, mitochondrial | |
Gene Name | MRPS33 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSLSEYAF ------CCCHHHHHH | 39.73 | 22223895 | |
2 | Phosphorylation | ------MSSLSEYAF ------CCCHHHHHH | 39.73 | 28857561 | |
3 | Phosphorylation | -----MSSLSEYAFR -----CCCHHHHHHH | 34.32 | 28857561 | |
5 | Phosphorylation | ---MSSLSEYAFRMS ---CCCHHHHHHHHH | 30.43 | 24043423 | |
7 | Phosphorylation | -MSSLSEYAFRMSRL -CCCHHHHHHHHHHH | 13.99 | 24043423 | |
12 | Phosphorylation | SEYAFRMSRLSARLF HHHHHHHHHHHHHHH | 26.30 | 24043423 | |
30 | Phosphorylation | TRPTNSKSMKVVKLF CCCCCCCCHHHHHHH | 24.53 | - | |
32 | Acetylation | PTNSKSMKVVKLFSE CCCCCCHHHHHHHHC | 51.47 | 7696763 | |
35 | Acetylation | SKSMKVVKLFSELPL CCCHHHHHHHHCCCC | 46.96 | 25953088 | |
38 | Phosphorylation | MKVVKLFSELPLAKK HHHHHHHHCCCCCCC | 48.97 | - | |
48 | Phosphorylation | PLAKKKETYDWYPNH CCCCCCCCCCCCCCC | 35.34 | 26552605 | |
49 | Phosphorylation | LAKKKETYDWYPNHH CCCCCCCCCCCCCCC | 12.93 | 26552605 | |
52 | Phosphorylation | KKETYDWYPNHHTYA CCCCCCCCCCCCHHH | 7.40 | 26552605 | |
57 | Phosphorylation | DWYPNHHTYAELMQT CCCCCCCHHHHHHHH | 19.51 | 26552605 | |
58 | Phosphorylation | WYPNHHTYAELMQTL CCCCCCHHHHHHHHH | 8.17 | 26552605 | |
64 | Phosphorylation | TYAELMQTLRFLGLY HHHHHHHHHHHHHCC | 13.11 | 26552605 | |
91 | Acetylation | RLKKLRGKEKPKKGE HHHHHCCCCCCCCCC | 57.01 | 20167786 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT33_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT33_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT33_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RT33_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...