UniProt ID | RT21_HUMAN | |
---|---|---|
UniProt AC | P82921 | |
Protein Name | 28S ribosomal protein S21, mitochondrial | |
Gene Name | MRPS21 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 87 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | HLKFIARTVMVQEGN HHHHHHHHHHHCCCC | 12.16 | 21406692 | |
21 | Phosphorylation | VQEGNVESAYRTLNR HCCCCHHHHHHHHHH | 26.73 | 21406692 | |
23 | Phosphorylation | EGNVESAYRTLNRIL CCCHHHHHHHHHHHH | 17.26 | 21406692 | |
25 | Phosphorylation | NVESAYRTLNRILTM CHHHHHHHHHHHHHH | 18.73 | 21406692 | |
31 | Phosphorylation | RTLNRILTMDGLIED HHHHHHHHHCCHHHH | 15.73 | 20860994 | |
32 | Sulfoxidation | TLNRILTMDGLIEDI HHHHHHHHCCHHHHH | 3.27 | 21406390 | |
40 | Ubiquitination | DGLIEDIKHRRYYEK CCHHHHHHHHHHCCC | 43.30 | 21890473 | |
40 | Acetylation | DGLIEDIKHRRYYEK CCHHHHHHHHHHCCC | 43.30 | 26822725 | |
40 | Ubiquitination | DGLIEDIKHRRYYEK CCHHHHHHHHHHCCC | 43.30 | 21890473 | |
44 | Phosphorylation | EDIKHRRYYEKPCCR HHHHHHHHCCCCCHH | 18.88 | 29496907 | |
47 | Acetylation | KHRRYYEKPCCRRQR HHHHHCCCCCHHHHH | 33.04 | 27452117 | |
64 | Phosphorylation | YERCRRIYNMEMARK HHHHHHHHHHHHHHH | 13.47 | 25690035 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT21_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT21_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT21_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RT21_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...