UniProt ID | LSM3_HUMAN | |
---|---|---|
UniProt AC | P62310 | |
Protein Name | U6 snRNA-associated Sm-like protein LSm3 | |
Gene Name | LSM3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 102 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds specifically to the 3'-terminal U-tract of U6 snRNA.. | |
Protein Sequence | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADDVDQQQ ------CCCCCCCHH | 23.01 | 22814378 | |
10 | Phosphorylation | DDVDQQQTTNTVEEP CCCCCHHHCCCCCCC | 20.06 | 19664995 | |
11 | Phosphorylation | DVDQQQTTNTVEEPL CCCCHHHCCCCCCCH | 25.26 | 30377224 | |
13 | Phosphorylation | DQQQTTNTVEEPLDL CCHHHCCCCCCCHHH | 27.48 | 30377224 | |
24 | Phosphorylation | PLDLIRLSLDERIYV CHHHHHHCCCCCEEE | 24.75 | 21815630 | |
28 | Methylation | IRLSLDERIYVKMRN HHHCCCCCEEEEECC | 25.79 | 115482369 | |
32 | Ubiquitination | LDERIYVKMRNDREL CCCCEEEEECCCHHH | 18.38 | - | |
71 | Phosphorylation | IEIDEETYEEIYKST EEECHHHHHHHHHHC | 18.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |