UniProt ID | WDR83_HUMAN | |
---|---|---|
UniProt AC | Q9BRX9 | |
Protein Name | WD repeat domain-containing protein 83 | |
Gene Name | WDR83 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 315 | |
Subcellular Localization | Cytoplasm. Nucleus. Predominantly cytoplasmic. Partially nuclear.. | |
Protein Description | Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). May also be involved in pre-mRNA splicing.. | |
Protein Sequence | MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Ubiquitination | RPPELPQKRLKTLDC CCCCCCHHHCCEECC | 58.73 | 29967540 | |
19 | Ubiquitination | ELPQKRLKTLDCGQG CCCHHHCCEECCCCC | 51.58 | 22505724 | |
39 | Phosphorylation | RFNVDGNYCLTCGSD EEEECCCEEEEECCC | 8.38 | 27642862 | |
47 | Ubiquitination | CLTCGSDKTLKLWNP EEEECCCCEEECCCC | 58.41 | 29967540 | |
50 | Ubiquitination | CGSDKTLKLWNPLRG ECCCCEEECCCCCCC | 57.60 | 29967540 | |
160 | Ubiquitination | RDGVSSVKVSDHEIL CCCCCEEEECCCEEE | 37.66 | - | |
206 | Phosphorylation | FSRDGQCTLVSSLDS ECCCCEEEEEECHHH | 23.47 | 26074081 | |
209 | Phosphorylation | DGQCTLVSSLDSTLR CCEEEEEECHHHHEE | 28.44 | 26074081 | |
210 | Phosphorylation | GQCTLVSSLDSTLRL CEEEEEECHHHHEEE | 28.81 | 26074081 | |
213 | Phosphorylation | TLVSSLDSTLRLLDK EEEECHHHHEEEECC | 34.33 | 26074081 | |
214 | Phosphorylation | LVSSLDSTLRLLDKD EEECHHHHEEEECCC | 18.63 | 26074081 | |
220 | Ubiquitination | STLRLLDKDTGELLG HHEEEECCCHHHHCC | 58.10 | 29967540 | |
222 | Phosphorylation | LRLLDKDTGELLGEY EEEECCCHHHHCCCC | 37.99 | 26074081 | |
230 | Ubiquitination | GELLGEYKGHKNQEY HHHCCCCCCCCCCEE | 50.68 | 29967540 | |
233 | Ubiquitination | LGEYKGHKNQEYKLD CCCCCCCCCCEEEEE | 69.83 | - | |
238 | Ubiquitination | GHKNQEYKLDCCLSE CCCCCEEEEEEECCC | 36.78 | 29967540 | |
244 | Phosphorylation | YKLDCCLSERDTHVV EEEEEECCCCCCEEE | 19.37 | 30631047 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR83_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR83_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR83_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...