UniProt ID | DCA13_HUMAN | |
---|---|---|
UniProt AC | Q9NV06 | |
Protein Name | DDB1- and CUL4-associated factor 13 | |
Gene Name | DCAF13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 445 | |
Subcellular Localization | Nucleus, nucleolus . In the nucleolus, localizes predominantly in the granular component, but also detected in the fibrillar center and dense fibrillar component. | |
Protein Description | Possible role in ribosomal RNA processing (By similarity). May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.. | |
Protein Sequence | MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Sumoylation | ----MKVKMLSRNPD ----CCCCCCCCCCC | 28.71 | - | |
7 | Phosphorylation | -MKVKMLSRNPDNYV -CCCCCCCCCCCCHH | 26.89 | 24719451 | |
13 | Phosphorylation | LSRNPDNYVRETKLD CCCCCCCHHHHHCCC | 14.31 | 27067055 | |
17 | Phosphorylation | PDNYVRETKLDLQRV CCCHHHHHCCCHHCC | 26.75 | 27067055 | |
18 | Sumoylation | DNYVRETKLDLQRVP CCHHHHHCCCHHCCC | 34.94 | - | |
18 | Ubiquitination | DNYVRETKLDLQRVP CCHHHHHCCCHHCCC | 34.94 | - | |
18 | Acetylation | DNYVRETKLDLQRVP CCHHHHHCCCHHCCC | 34.94 | 25953088 | |
28 | Phosphorylation | LQRVPRNYDPALHPF HHCCCCCCCCCCCCC | 25.28 | 27642862 | |
48 | Phosphorylation | YIRALNATKLERVFA HHHHHCCHHHHHHHC | 34.78 | 22617229 | |
49 | Sumoylation | IRALNATKLERVFAK HHHHCCHHHHHHHCH | 46.04 | - | |
49 (in isoform 2) | Ubiquitination | - | 46.04 | 21890473 | |
49 | Acetylation | IRALNATKLERVFAK HHHHCCHHHHHHHCH | 46.04 | 19608861 | |
49 | Ubiquitination | IRALNATKLERVFAK HHHHCCHHHHHHHCH | 46.04 | - | |
56 (in isoform 2) | Ubiquitination | - | 25.49 | 21890473 | |
56 | Ubiquitination | KLERVFAKPFLASLD HHHHHHCHHHHHHCC | 25.49 | 21890473 | |
56 | Acetylation | KLERVFAKPFLASLD HHHHHHCHHHHHHCC | 25.49 | 23749302 | |
74 | Ubiquitination | DGVNCLAKHPEKLAT CCCCHHHCCHHHHHH | 46.90 | - | |
78 | Ubiquitination | CLAKHPEKLATVLSG HHHCCHHHHHHHHHC | 48.12 | - | |
78 | Acetylation | CLAKHPEKLATVLSG HHHCCHHHHHHHHHC | 48.12 | 26051181 | |
131 | Ubiquitination | FFTVGDDKTVKQWKM EEEECCCCCEEEEEC | 61.02 | - | |
134 | Ubiquitination | VGDDKTVKQWKMDGP ECCCCCEEEEECCCC | 56.52 | - | |
137 | Ubiquitination | DKTVKQWKMDGPGYG CCCEEEEECCCCCCC | 25.31 | - | |
170 | Sumoylation | DHHWKEAVFATCGQQ CHHHHHHHHHHCCCE | 3.35 | - | |
170 | Ubiquitination | DHHWKEAVFATCGQQ CHHHHHHHHHHCCCE | 3.35 | - | |
200 | Phosphorylation | TWGFDSISSVKFNPI ECCCCCCEEEECCCC | 32.79 | - | |
201 | Acetylation | WGFDSISSVKFNPIE CCCCCCEEEECCCCC | 27.88 | 19608861 | |
201 | Sumoylation | WGFDSISSVKFNPIE CCCCCCEEEECCCCC | 27.88 | 19608861 | |
201 | Ubiquitination | WGFDSISSVKFNPIE CCCCCCEEEECCCCC | 27.88 | 19608861 | |
201 (in isoform 1) | Ubiquitination | - | 27.88 | 21890473 | |
208 | Ubiquitination | SVKFNPIETFLLGSC EEECCCCCEEEECCC | 34.46 | - | |
208 | Acetylation | SVKFNPIETFLLGSC EEECCCCCEEEECCC | 34.46 | - | |
208 (in isoform 1) | Ubiquitination | - | 34.46 | 21890473 | |
224 | Phosphorylation | SDRNIVLYDMRQATP CCCCEEEEECCCCCC | 9.22 | 22817900 | |
226 | Ubiquitination | RNIVLYDMRQATPLK CCEEEEECCCCCCCC | 1.85 | - | |
227 | Methylation | NIVLYDMRQATPLKK CEEEEECCCCCCCCE | 21.78 | 115920045 | |
230 | Ubiquitination | LYDMRQATPLKKVIL EEECCCCCCCCEEEE | 22.33 | - | |
234 | Ubiquitination | RQATPLKKVILDMRT CCCCCCCEEEEECCC | 42.04 | - | |
283 | Ubiquitination | MVHMDHVSAVLDVDY EEECCCEEEEEEECC | 14.83 | - | |
289 (in isoform 1) | Ubiquitination | - | 37.55 | 21890473 | |
289 | Ubiquitination | VSAVLDVDYSPTGKE EEEEEEECCCCCCCC | 37.55 | - | |
304 | Ubiquitination | FVSASFDKSIRIFPV EEEEECCCEEEEEEC | 45.85 | 21890473 | |
313 | Ubiquitination | IRIFPVDKSRSREVY EEEEECCCCCCCCEE | 48.26 | - | |
320 | Phosphorylation | KSRSREVYHTKRMQH CCCCCCEECCCCCCE | 10.06 | - | |
332 | Acetylation | MQHVICVKWTSDSKY CCEEEEEEECCCCCE | 40.10 | 26051181 | |
353 | Methylation | EMNIRLWKANASEKL HHHHEEEECCHHHHH | 36.03 | 115978595 | |
353 | Ubiquitination | EMNIRLWKANASEKL HHHHEEEECCHHHHH | 36.03 | - | |
359 | Ubiquitination | WKANASEKLGVLTSR EECCHHHHHCCCCCH | 48.31 | 21890473 | |
359 | Sumoylation | WKANASEKLGVLTSR EECCHHHHHCCCCCH | 48.31 | - | |
376 | Ubiquitination | AAKDYNQKLKEKFQH HHHHHHHHHHHHHCC | 58.87 | - | |
379 | Methylation | DYNQKLKEKFQHYPH HHHHHHHHHHCCCHH | 70.33 | - | |
386 | Ubiquitination | EKFQHYPHIKRIARH HHHCCCHHHHHHHHH | 30.91 | - | |
398 | Ubiquitination | ARHRHLPKSIYSQIQ HHHCCCCHHHHHHHH | 56.71 | 21890473 | |
398 | Acetylation | ARHRHLPKSIYSQIQ HHHCCCCHHHHHHHH | 56.71 | 26051181 | |
399 | Phosphorylation | RHRHLPKSIYSQIQE HHCCCCHHHHHHHHH | 25.48 | 29978859 | |
401 | Phosphorylation | RHLPKSIYSQIQEQR CCCCHHHHHHHHHHH | 11.12 | 28152594 | |
402 | Phosphorylation | HLPKSIYSQIQEQRI CCCHHHHHHHHHHHH | 21.09 | 28152594 | |
423 | Acetylation | RKEVNRIKHSKPGSV HHHHHCCCCCCCCCC | 38.29 | 7364639 | |
434 | Phosphorylation | PGSVPLVSEKKKHVV CCCCCCCCCCCCEEE | 51.92 | 25159151 | |
436 | Acetylation | SVPLVSEKKKHVVAV CCCCCCCCCCEEEEE | 60.66 | 7364647 | |
456 | Ubiquitination | ------------------ ------------------ | - | ||
456 (in isoform 1) | Ubiquitination | - | 21890473 | ||
465 | Ubiquitination | --------------------------- --------------------------- | - | ||
505 | Ubiquitination | ------------------------------------------------------------------- ------------------------------------------------------------------- | - | ||
505 | Methylation | ------------------------------------------------------------------- ------------------------------------------------------------------- | - | ||
511 | Ubiquitination | ------------------------------------------------------------------------- ------------------------------------------------------------------------- | - | ||
511 (in isoform 1) | Ubiquitination | - | 21890473 | ||
511 | Sumoylation | ------------------------------------------------------------------------- ------------------------------------------------------------------------- | - | ||
528 | Ubiquitination | ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------ | - | ||
532 | Ubiquitination | ---------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------- | - | ||
550 | Ubiquitination | ---------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------- | - | ||
550 (in isoform 1) | Ubiquitination | - | 21890473 | ||
575 | Ubiquitination | ----------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------- | - | ||
578 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
586 | Phosphorylation | ---------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCA13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCA13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCA13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBL3_HUMAN | TBL3 | physical | 26344197 | |
UT14A_HUMAN | UTP14A | physical | 26344197 | |
WDR36_HUMAN | WDR36 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-49, AND MASS SPECTROMETRY. |