LTOR3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LTOR3_HUMAN
• UniProt AC: Q9UHA4
• Protein Name: Ragulator complex protein LAMTOR3
• Gene Name: LAMTOR3
• Organism: Homo sapiens (Human).
• Sequence Length: 124
• Subcellular Localization: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side.
• Protein Description: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2..
• Protein Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Ubiquitination	GFLSTFALATDQGSK CCCHHEEEECCCCCC	4.62	22817900
60	Ubiquitination	FALATDQGSKLGLSK EEEECCCCCCCCCCC	29.56	22817900
62	Ubiquitination	LATDQGSKLGLSKNK EECCCCCCCCCCCCC	54.09	21890473
67	Ubiquitination	GSKLGLSKNKSIICY CCCCCCCCCCEEEEE	73.72	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LTOR3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LTOR3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LTOR3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MP2K1_HUMAN	MAP2K1	physical	9733512
MK03_HUMAN	MAPK3	physical	9733512
CDN2A_HUMAN	CDKN2A	physical	20655927
ARF_HUMAN	CDKN2A	physical	20655927
MYOME_HUMAN	PDE4DIP	physical	21900206
CPNE6_HUMAN	CPNE6	physical	21900206
UBR1_HUMAN	UBR1	physical	21900206
ATS10_HUMAN	ADAMTS10	physical	21900206
SYQ_HUMAN	QARS	physical	21900206
CEBPZ_HUMAN	CEBPZ	physical	21900206
RAB21_HUMAN	RAB21	physical	22939629
NNTM_HUMAN	NNT	physical	22939629
NDUA2_HUMAN	NDUFA2	physical	22939629
VATE1_HUMAN	ATP6V1E1	physical	22939629
MPV17_HUMAN	MPV17	physical	22939629
RALB_HUMAN	RALB	physical	22939629
PICAL_HUMAN	PICALM	physical	22939629
RT35_HUMAN	MRPS35	physical	22939629
RAB5C_HUMAN	RAB5C	physical	22939629
RM22_HUMAN	MRPL22	physical	22939629
TSR1_HUMAN	TSR1	physical	22939629
NDUBB_HUMAN	NDUFB11	physical	22939629
TOM22_HUMAN	TOMM22	physical	22939629
SSBP_HUMAN	SSBP1	physical	22939629
ZBT43_HUMAN	ZBTB43	physical	22939629
MSLN_HUMAN	MSLN	physical	22939629
PCAT1_HUMAN	LPCAT1	physical	22939629
RAB14_HUMAN	RAB14	physical	22939629
NDUB7_HUMAN	NDUFB7	physical	22939629
RS7_HUMAN	RPS7	physical	22939629
PUF60_HUMAN	PUF60	physical	22939629
TOM70_HUMAN	TOMM70A	physical	22939629
MTCH1_HUMAN	MTCH1	physical	22939629
NDUB5_HUMAN	NDUFB5	physical	22939629
NDUB9_HUMAN	NDUFB9	physical	22939629
PTH2_HUMAN	PTRH2	physical	22939629
TOM40_HUMAN	TOMM40	physical	22939629
RM43_HUMAN	MRPL43	physical	22939629
QCR8_HUMAN	UQCRQ	physical	22939629
NUP58_HUMAN	NUPL1	physical	22939629
RAB31_HUMAN	RAB31	physical	22939629
RHOB_HUMAN	RHOB	physical	22939629
MRM3_HUMAN	RNMTL1	physical	22939629
RALA_HUMAN	RALA	physical	22939629
PTN1_HUMAN	PTPN1	physical	22939629
RT09_HUMAN	MRPS9	physical	22939629
NDUB4_HUMAN	NDUFB4	physical	22939629
RS18_HUMAN	RPS18	physical	22939629
PEF1_HUMAN	PEF1	physical	22939629
SPCS2_HUMAN	SPCS2	physical	22939629
RM47_HUMAN	MRPL47	physical	22939629
PRR3_HUMAN	PRR3	physical	22939629
MIC13_HUMAN	C19orf70	physical	22939629
TMCO1_HUMAN	TMCO1	physical	22939629
RM51_HUMAN	MRPL51	physical	22939629
VDAC3_HUMAN	VDAC3	physical	22939629
RM39_HUMAN	MRPL39	physical	22939629
RAB2A_HUMAN	RAB2A	physical	22939629
VAMP2_HUMAN	VAMP2	physical	22939629
LTOR2_HUMAN	LAMTOR2	physical	21988832
MBD2_HUMAN	MBD2	physical	21988832
LTOR2_HUMAN	LAMTOR2	physical	25416956
NIF3L_HUMAN	NIF3L1	physical	25416956
CDN2A_HUMAN	CDKN2A	physical	18479705
ARF_HUMAN	CDKN2A	physical	18479705

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.