UniProt ID | LTOR3_HUMAN | |
---|---|---|
UniProt AC | Q9UHA4 | |
Protein Name | Ragulator complex protein LAMTOR3 | |
Gene Name | LAMTOR3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 124 | |
Subcellular Localization |
Late endosome membrane Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.. | |
Protein Sequence | MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Ubiquitination | GFLSTFALATDQGSK CCCHHEEEECCCCCC | 4.62 | 22817900 | |
60 | Ubiquitination | FALATDQGSKLGLSK EEEECCCCCCCCCCC | 29.56 | 22817900 | |
62 | Ubiquitination | LATDQGSKLGLSKNK EECCCCCCCCCCCCC | 54.09 | 21890473 | |
67 | Ubiquitination | GSKLGLSKNKSIICY CCCCCCCCCCEEEEE | 73.72 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LTOR3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LTOR3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LTOR3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...