| UniProt ID | CDN2A_HUMAN | |
|---|---|---|
| UniProt AC | P42771 | |
| Protein Name | Cyclin-dependent kinase inhibitor 2A {ECO:0000312|HGNC:HGNC:1787} | |
| Gene Name | CDKN2A {ECO:0000312|HGNC:HGNC:1787} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 156 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.. | |
| Protein Sequence | MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEPAAGSS -------CCCCCCCC | 22814378 | ||
| 7 | Phosphorylation | -MEPAAGSSMEPSAD -CCCCCCCCCCCCHH | 20152798 | ||
| 8 | Phosphorylation | MEPAAGSSMEPSADW CCCCCCCCCCCCHHH | 20152798 | ||
| 44 | Phosphorylation | LPNAPNSYGRRPIQV CCCCCCCCCCCCCEE | 21214269 | ||
| 44 | Nitration | LPNAPNSYGRRPIQV CCCCCCCCCCCCCEE | - | ||
| 56 | Phosphorylation | IQVMMMGSARVAELL CEEEECCCHHHHHHH | 27732954 | ||
| 76 (in isoform 3) | Phosphorylation | - | - | ||
| 76 | Phosphorylation | EPNCADPATLTRPVH CCCCCCCHHCCCCHH | - | ||
| 78 | Phosphorylation | NCADPATLTRPVHDA CCCCCHHCCCCHHHH | - | ||
| 78 (in isoform 3) | Phosphorylation | - | - | ||
| 99 | Methylation | DTLVVLHRAGARLDV HHHHHHHHCCCCCCH | - | ||
| 129 | Phosphorylation | GHRDVARYLRAAAGG CCHHHHHHHHHHHCC | 22210691 | ||
| 129 | Nitration | GHRDVARYLRAAAGG CCHHHHHHHHHHHCC | - | ||
| 131 | Methylation | RDVARYLRAAAGGTR HHHHHHHHHHHCCCC | 115486137 | ||
| 137 | Phosphorylation | LRAAAGGTRGSNHAR HHHHHCCCCCCCCCC | 22210691 | ||
| 138 | Methylation | RAAAGGTRGSNHARI HHHHCCCCCCCCCCC | 125812017 | ||
| 140 | Phosphorylation | AAGGTRGSNHARIDA HHCCCCCCCCCCCCC | 30576142 | ||
| 152 | Phosphorylation | IDAAEGPSDIPD--- CCCCCCCCCCCC--- | 10484981 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 7 | S | Phosphorylation | Kinase | ATR | Q13535 | PSP |
| 8 | S | Phosphorylation | Kinase | ATR | Q13535 | PSP |
| 8 | S | Phosphorylation | Kinase | IKBKB | O14920 | GPS |
| 140 | S | Phosphorylation | Kinase | ATR | Q13535 | PSP |
| 152 | S | Phosphorylation | Kinase | ATR | Q13535 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDN2A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDN2A_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| Note=The association between cutaneous and uveal melanomas in some families suggests that mutations in CDKN2A may account for a proportion of uveal melanomas. However, CDKN2A mutations are rarely found in uveal melanoma patients. | ||||||
| 155601 | ||||||
| 606719 | Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome (FAMMMPC) | |||||
| 151623 | Li-Fraumeni syndrome (LFS) | |||||
| 155755 | Melanoma-astrocytoma syndrome (MASTS) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
