UniProt ID | LSM8_HUMAN | |
---|---|---|
UniProt AC | O95777 | |
Protein Name | U6 snRNA-associated Sm-like protein LSm8 | |
Gene Name | LSM8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 96 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds specifically to the 3'-terminal U-tract of U6 snRNA and is probably a component of the spliceosome.. | |
Protein Sequence | MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTSALENYI ------CCHHHHHHH | 22223895 | ||
2 | Phosphorylation | ------MTSALENYI ------CCHHHHHHH | 23186163 | ||
3 | Phosphorylation | -----MTSALENYIN -----CCHHHHHHHC | 23186163 | ||
18 | Phosphorylation | RTVAVITSDGRMIVG CEEEEEECCCCEEEE | 21712546 | ||
26 | O-linked_Glycosylation | DGRMIVGTLKGFDQT CCCEEEEEECCCHHH | 25367160 | ||
28 | Ubiquitination | RMIVGTLKGFDQTIN CEEEEEECCCHHHHH | - | ||
47 | Phosphorylation | ESHERVFSSSQGVEQ CCHHHHCCCCCCCEE | 25159151 | ||
48 | Phosphorylation | SHERVFSSSQGVEQV CHHHHCCCCCCCEEE | 28464451 | ||
49 | Phosphorylation | HERVFSSSQGVEQVV HHHHCCCCCCCEEEE | 22617229 | ||
60 | Phosphorylation | EQVVLGLYIVRGDNV EEEEEEEEEEECCEE | 27080861 | ||
77 | Phosphorylation | IGEIDEETDSALDLG EEEECCCCCCCCCCC | 25693802 | ||
79 | Phosphorylation | EIDEETDSALDLGNI EECCCCCCCCCCCCC | 25693802 | ||
93 | Phosphorylation | IRAEPLNSVAH---- CCCEECCCCCC---- | 26091039 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM8_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...