| UniProt ID | LSM8_HUMAN | |
|---|---|---|
| UniProt AC | O95777 | |
| Protein Name | U6 snRNA-associated Sm-like protein LSm8 | |
| Gene Name | LSM8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 96 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Binds specifically to the 3'-terminal U-tract of U6 snRNA and is probably a component of the spliceosome.. | |
| Protein Sequence | MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MTSALENYI ------CCHHHHHHH | 22223895 | ||
| 2 | Phosphorylation | ------MTSALENYI ------CCHHHHHHH | 23186163 | ||
| 3 | Phosphorylation | -----MTSALENYIN -----CCHHHHHHHC | 23186163 | ||
| 18 | Phosphorylation | RTVAVITSDGRMIVG CEEEEEECCCCEEEE | 21712546 | ||
| 26 | O-linked_Glycosylation | DGRMIVGTLKGFDQT CCCEEEEEECCCHHH | 25367160 | ||
| 28 | Ubiquitination | RMIVGTLKGFDQTIN CEEEEEECCCHHHHH | - | ||
| 47 | Phosphorylation | ESHERVFSSSQGVEQ CCHHHHCCCCCCCEE | 25159151 | ||
| 48 | Phosphorylation | SHERVFSSSQGVEQV CHHHHCCCCCCCEEE | 28464451 | ||
| 49 | Phosphorylation | HERVFSSSQGVEQVV HHHHCCCCCCCEEEE | 22617229 | ||
| 60 | Phosphorylation | EQVVLGLYIVRGDNV EEEEEEEEEEECCEE | 27080861 | ||
| 77 | Phosphorylation | IGEIDEETDSALDLG EEEECCCCCCCCCCC | 25693802 | ||
| 79 | Phosphorylation | EIDEETDSALDLGNI EECCCCCCCCCCCCC | 25693802 | ||
| 93 | Phosphorylation | IRAEPLNSVAH---- CCCEECCCCCC---- | 26091039 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM8_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...