VAMP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAMP1_HUMAN
• UniProt AC: P23763
• Protein Name: Vesicle-associated membrane protein 1
• Gene Name: VAMP1
• Organism: Homo sapiens (Human).
• Sequence Length: 118
• Subcellular Localization: Isoform 1: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.; Isoform 2: Cytoplasmic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSAPAQPPA ------CCCCCCCCC	42.85	-
54	Ubiquitination	IIRVNVDKVLERDQK HHHHCHHHHHHHHHH	44.42	21139048
54	Acetylation	IIRVNVDKVLERDQK HHHHCHHHHHHHHHH	44.42	25953088
54 (in isoform 1)	Ubiquitination	-	44.42	21890473
54 (in isoform 2)	Ubiquitination	-	44.42	21890473
54 (in isoform 3)	Ubiquitination	-	44.42	21890473
61	Ubiquitination	KVLERDQKLSELDDR HHHHHHHHHHHHHHH	59.26	21906983
61 (in isoform 1)	Ubiquitination	-	59.26	21890473
61 (in isoform 2)	Ubiquitination	-	59.26	21890473
61 (in isoform 3)	Ubiquitination	-	59.26	21890473
63	Phosphorylation	LERDQKLSELDDRAD HHHHHHHHHHHHHHH	43.05	23911959
77	Phosphorylation	DALQAGASQFESSAA HHHHHHHHHHHHHHH	34.19	25307156
85	Ubiquitination	QFESSAAKLKRKYWW HHHHHHHHHHHHHHH	55.01	2190698
85 (in isoform 2)	Ubiquitination	-	55.01	21890473
85 (in isoform 1)	Ubiquitination	-	55.01	21890473
85 (in isoform 3)	Ubiquitination	-	55.01	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VAMP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAMP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAMP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VAPB_HUMAN	VAPB	physical	9920726
STX4_HUMAN	STX4	physical	8760387
SNP29_HUMAN	SNAP29	physical	25416956
KASH5_HUMAN	CCDC155	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 108600: Spastic ataxia 1, autosomal dominant (SPAX1)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00042: Botulinum Toxin Type B