| UniProt ID | TP4A3_HUMAN | |
|---|---|---|
| UniProt AC | O75365 | |
| Protein Name | Protein tyrosine phosphatase type IVA 3 | |
| Gene Name | PTP4A3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 173 | |
| Subcellular Localization | Cell membrane . Early endosome . | |
| Protein Description | Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II.. | |
| Protein Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | RPAPVEVSYKHMRFL CCCCEEEEECCCEEE | 18.24 | 24719451 | |
| 14 | Phosphorylation | PAPVEVSYKHMRFLI CCCEEEEECCCEEEE | 15.30 | 24719451 | |
| 40 | Phosphorylation | FIEDLKKYGATTVVR HHHHHHHCCCEEEEE | 15.48 | 27762562 | |
| 86 | Phosphorylation | KVVEDWLSLVKAKFC CCHHHHHHHHHHHHC | 27.19 | 24719451 | |
| 119 | Ubiquitination | PVLVALALIESGMKY HHHHHHHHHHCCCCH | 4.67 | 32142685 | |
| 122 | Phosphorylation | VALALIESGMKYEDA HHHHHHHCCCCHHHH | 36.87 | 30301811 | |
| 144 | Ubiquitination | RRGAINSKQLTYLEK HCCCCCHHHHHHHHH | 44.85 | 32142685 | |
| 155 | Acetylation | YLEKYRPKQRLRFKD HHHHHCCCCCCCCCC | 38.77 | 20167786 | |
| 167 | Acetylation | FKDPHTHKTRCCVM- CCCCCCCCCCEEEC- | 38.53 | 20167786 | |
| 170 | Methylation | PHTHKTRCCVM---- CCCCCCCEEEC---- | 2.19 | - | |
| 170 | Farnesylation | PHTHKTRCCVM---- CCCCCCCEEEC---- | 2.19 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TP4A3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TP4A3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...