TMM33_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMM33_HUMAN
• UniProt AC: P57088
• Protein Name: Transmembrane protein 33
• Gene Name: TMEM33
• Organism: Homo sapiens (Human).
• Sequence Length: 247
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Melanosome . Nucleus envelope . Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Co-localizes with RTN4 at the ER sheets.
• Protein Description: Acts as a regulator of the tubular endoplasmic reticulum (ER) network. Suppresses the RTN3/4-induced formation of the ER tubules. [PubMed: 25612671 Positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling]
• Protein Sequence: MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADTTPNGP ------CCCCCCCCC	23.90	22223895
4	Phosphorylation	----MADTTPNGPQG ----CCCCCCCCCCC	34.32	29759185
5	Phosphorylation	---MADTTPNGPQGA ---CCCCCCCCCCCC	18.46	29759185
25	Phosphorylation	MMTNKLDTAMWLSRL HHCCCHHHHHHHHHH	28.93	-
65	Phosphorylation	ALLANALTSALRLHQ HHHHHHHHHHHHHHH	15.00	21406692
66	Phosphorylation	LLANALTSALRLHQR HHHHHHHHHHHHHHH	26.59	21406692
134	Methylation	TKKVLDARGSNSLPL HHHHHHCCCCCCHHH	49.06	54425405
136	Phosphorylation	KVLDARGSNSLPLLR HHHHCCCCCCHHHHH	20.07	28348404
138	Phosphorylation	LDARGSNSLPLLRSV HHCCCCCCHHHHHHH	32.82	28348404
148	Ubiquitination	LLRSVLDKLSANQQN HHHHHHHHHCCCHHH	39.93	21890473
148	2-Hydroxyisobutyrylation	LLRSVLDKLSANQQN HHHHHHHHHCCCHHH	39.93	-
148	Acetylation	LLRSVLDKLSANQQN HHHHHHHHHCCCHHH	39.93	26051181
150	Phosphorylation	RSVLDKLSANQQNIL HHHHHHHCCCHHHHH	30.80	30622161
221	Ubiquitination	VVEHIIMKPACPLFV HHHHHHHCCCCHHHH	21.03	-
221	Acetylation	VVEHIIMKPACPLFV HHHHHHHCCCCHHHH	21.03	25953088

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMM33_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMM33_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMM33_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MRP1_HUMAN	ABCC1	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.