APC15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APC15_HUMAN
• UniProt AC: P60006
• Protein Name: Anaphase-promoting complex subunit 15
• Gene Name: ANAPC15
• Organism: Homo sapiens (Human).
• Sequence Length: 121
• Protein Description: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20..
• Protein Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	VPIGKPASEHYDDEE EECCCCHHHCCCCCC	33.17	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APC15_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APC15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APC15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC1_HUMAN	ANAPC1	physical	23007861
ANC2_HUMAN	ANAPC2	physical	23007861
CDC27_HUMAN	CDC27	physical	23007861
APC4_HUMAN	ANAPC4	physical	23007861
APC5_HUMAN	ANAPC5	physical	23007861
CDC16_HUMAN	CDC16	physical	23007861
APC7_HUMAN	ANAPC7	physical	23007861
CDC23_HUMAN	CDC23	physical	23007861
APC10_HUMAN	ANAPC10	physical	23007861
CDC26_HUMAN	CDC26	physical	23007861
CDC20_HUMAN	CDC20	physical	23007861
CDC20_HUMAN	CDC20	physical	26496610
CDC27_HUMAN	CDC27	physical	26496610
NEK2_HUMAN	NEK2	physical	26496610
PRDX1_HUMAN	PRDX1	physical	26496610
RIR2_HUMAN	RRM2	physical	26496610
RTKN_HUMAN	RTKN	physical	26496610
PRDX2_HUMAN	PRDX2	physical	26496610
KITM_HUMAN	TK2	physical	26496610
PFD3_HUMAN	VBP1	physical	26496610
CDC23_HUMAN	CDC23	physical	26496610
CDC16_HUMAN	CDC16	physical	26496610
US6NL_HUMAN	USP6NL	physical	26496610
VINEX_HUMAN	SORBS3	physical	26496610
DHRS2_HUMAN	DHRS2	physical	26496610
INADL_HUMAN	INADL	physical	26496610
APC10_HUMAN	ANAPC10	physical	26496610
PLPHP_HUMAN	PROSC	physical	26496610
ECD_HUMAN	ECD	physical	26496610
PACS2_HUMAN	PACS2	physical	26496610
PRDX5_HUMAN	PRDX5	physical	26496610
APC13_HUMAN	ANAPC13	physical	26496610
FBX5_HUMAN	FBXO5	physical	26496610
ANC2_HUMAN	ANAPC2	physical	26496610
APC4_HUMAN	ANAPC4	physical	26496610
FZR1_HUMAN	FZR1	physical	26496610
APC5_HUMAN	ANAPC5	physical	26496610
APC7_HUMAN	ANAPC7	physical	26496610
SIR6_HUMAN	SIRT6	physical	26496610
NEB1_HUMAN	PPP1R9A	physical	26496610
Z512B_HUMAN	ZNF512B	physical	26496610
CFA97_HUMAN	CFAP97	physical	26496610
DEN1A_HUMAN	DENND1A	physical	26496610
APC1_HUMAN	ANAPC1	physical	26496610
RM11_HUMAN	MRPL11	physical	26496610
GNPTA_HUMAN	GNPTAB	physical	26496610
GNPTG_HUMAN	GNPTG	physical	26496610
RRFM_HUMAN	MRRF	physical	26496610
C1QT6_HUMAN	C1QTNF6	physical	26496610
APC16_HUMAN	ANAPC16	physical	26496610
CDC26_HUMAN	CDC26	physical	26496610
BRNP1_HUMAN	BRINP1	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.