| UniProt ID | KITM_HUMAN | |
|---|---|---|
| UniProt AC | O00142 | |
| Protein Name | Thymidine kinase 2, mitochondrial | |
| Gene Name | TK2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 265 | |
| Subcellular Localization | Mitochondrion. | |
| Protein Description | Phosphorylates thymidine, deoxycytidine, and deoxyuridine in the mitochondrial matrix. In non-replicating cells, where cytosolic dNTP synthesis is down-regulated, mtDNA synthesis depends solely on TK2 and DGUOK. Widely used as target of antiviral and chemotherapeutic agents.. | |
| Protein Sequence | MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 (in isoform 2) | Phosphorylation | - | 4.74 | 30631047 | |
| 10 (in isoform 2) | Phosphorylation | - | 7.01 | 30631047 | |
| 21 | Phosphorylation | LRCFGPGSRGSPASG HHHCCCCCCCCCCCC | 36.28 | - | |
| 24 | Phosphorylation | FGPGSRGSPASGPGP CCCCCCCCCCCCCCC | 19.04 | - | |
| 84 | Phosphorylation | EVLTEPVSKWRNVRG EHHCCCCHHHCCCCC | 36.90 | 24275569 | |
| 99 | Phosphorylation | HNPLGLMYHDASRWG CCCCCEEEECHHHHC | 11.11 | 27259358 | |
| 108 | Phosphorylation | DASRWGLTLQTYVQL CHHHHCCCHHHHHHH | 16.94 | 25072903 | |
| 111 | Phosphorylation | RWGLTLQTYVQLTML HHCCCHHHHHHHHCC | 28.86 | 25072903 | |
| 112 | Phosphorylation | WGLTLQTYVQLTMLD HCCCHHHHHHHHCCC | 3.53 | 25072903 | |
| 116 | Phosphorylation | LQTYVQLTMLDRHTR HHHHHHHHCCCCCCC | 9.90 | 25072903 | |
| 122 | Phosphorylation | LTMLDRHTRPQVSSV HHCCCCCCCCCCCHH | 44.96 | 25072903 | |
| 127 | Phosphorylation | RHTRPQVSSVRLMER CCCCCCCCHHHHHHH | 20.19 | 25072903 | |
| 128 | Phosphorylation | HTRPQVSSVRLMERS CCCCCCCHHHHHHHH | 16.64 | 25072903 | |
| 181 | Phosphorylation | VSVDLIVYLRTNPET CCEEEEEEECCCHHH | 5.40 | - | |
| 184 | Phosphorylation | DLIVYLRTNPETCYQ EEEEEECCCHHHHHH | 53.16 | - | |
| 188 | Phosphorylation | YLRTNPETCYQRLKK EECCCHHHHHHHHHH | 20.12 | - | |
| 189 | Glutathionylation | LRTNPETCYQRLKKR ECCCHHHHHHHHHHH | 2.31 | 22833525 | |
| 190 | Phosphorylation | RTNPETCYQRLKKRC CCCHHHHHHHHHHHH | 12.23 | - | |
| 257 | Phosphorylation | QNRDRILTPENRKHC HCHHHCCCCCHHCCC | 26.62 | 28258704 | |
| 264 | Glutathionylation | TPENRKHCP------ CCCHHCCCC------ | 4.86 | 22833525 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KITM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KITM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KITM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KITM_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
