UniProt ID | KITM_HUMAN | |
---|---|---|
UniProt AC | O00142 | |
Protein Name | Thymidine kinase 2, mitochondrial | |
Gene Name | TK2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 265 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Phosphorylates thymidine, deoxycytidine, and deoxyuridine in the mitochondrial matrix. In non-replicating cells, where cytosolic dNTP synthesis is down-regulated, mtDNA synthesis depends solely on TK2 and DGUOK. Widely used as target of antiviral and chemotherapeutic agents.. | |
Protein Sequence | MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 (in isoform 2) | Phosphorylation | - | 4.74 | 30631047 | |
10 (in isoform 2) | Phosphorylation | - | 7.01 | 30631047 | |
21 | Phosphorylation | LRCFGPGSRGSPASG HHHCCCCCCCCCCCC | 36.28 | - | |
24 | Phosphorylation | FGPGSRGSPASGPGP CCCCCCCCCCCCCCC | 19.04 | - | |
84 | Phosphorylation | EVLTEPVSKWRNVRG EHHCCCCHHHCCCCC | 36.90 | 24275569 | |
99 | Phosphorylation | HNPLGLMYHDASRWG CCCCCEEEECHHHHC | 11.11 | 27259358 | |
108 | Phosphorylation | DASRWGLTLQTYVQL CHHHHCCCHHHHHHH | 16.94 | 25072903 | |
111 | Phosphorylation | RWGLTLQTYVQLTML HHCCCHHHHHHHHCC | 28.86 | 25072903 | |
112 | Phosphorylation | WGLTLQTYVQLTMLD HCCCHHHHHHHHCCC | 3.53 | 25072903 | |
116 | Phosphorylation | LQTYVQLTMLDRHTR HHHHHHHHCCCCCCC | 9.90 | 25072903 | |
122 | Phosphorylation | LTMLDRHTRPQVSSV HHCCCCCCCCCCCHH | 44.96 | 25072903 | |
127 | Phosphorylation | RHTRPQVSSVRLMER CCCCCCCCHHHHHHH | 20.19 | 25072903 | |
128 | Phosphorylation | HTRPQVSSVRLMERS CCCCCCCHHHHHHHH | 16.64 | 25072903 | |
181 | Phosphorylation | VSVDLIVYLRTNPET CCEEEEEEECCCHHH | 5.40 | - | |
184 | Phosphorylation | DLIVYLRTNPETCYQ EEEEEECCCHHHHHH | 53.16 | - | |
188 | Phosphorylation | YLRTNPETCYQRLKK EECCCHHHHHHHHHH | 20.12 | - | |
189 | Glutathionylation | LRTNPETCYQRLKKR ECCCHHHHHHHHHHH | 2.31 | 22833525 | |
190 | Phosphorylation | RTNPETCYQRLKKRC CCCHHHHHHHHHHHH | 12.23 | - | |
257 | Phosphorylation | QNRDRILTPENRKHC HCHHHCCCCCHHCCC | 26.62 | 28258704 | |
264 | Glutathionylation | TPENRKHCP------ CCCHHCCCC------ | 4.86 | 22833525 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KITM_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KITM_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KITM_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KITM_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...