APC13_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APC13_HUMAN
• UniProt AC: Q9BS18
• Protein Name: Anaphase-promoting complex subunit 13
• Gene Name: ANAPC13
• Organism: Homo sapiens (Human).
• Sequence Length: 74
• Subcellular Localization: Nucleus .
• Protein Description: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains..
• Protein Sequence: MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	WREDKLPYEDVAIPL HHCCCCCHHHCEEEH	34.89	27642862

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APC13_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APC13_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APC13_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC4_HUMAN	ANAPC4	physical	22939629
CDC27_HUMAN	CDC27	physical	22939629
CDC16_HUMAN	CDC16	physical	22939629
APC5_HUMAN	ANAPC5	physical	22939629
CDC23_HUMAN	CDC23	physical	22939629
APC7_HUMAN	ANAPC7	physical	22939629
CDC26_HUMAN	CDC26	physical	22939629
TAF4_HUMAN	TAF4	physical	26344197
APC4_HUMAN	ANAPC4	physical	28514442
CDC16_HUMAN	CDC16	physical	28514442
ANC2_HUMAN	ANAPC2	physical	28514442
CDC26_HUMAN	CDC26	physical	28514442
CDC27_HUMAN	CDC27	physical	28514442
CDC23_HUMAN	CDC23	physical	28514442
APC5_HUMAN	ANAPC5	physical	28514442
APC1_HUMAN	ANAPC1	physical	28514442
APC16_HUMAN	ANAPC16	physical	28514442
APC7_HUMAN	ANAPC7	physical	28514442
FZR1_HUMAN	FZR1	physical	28514442
FBX5_HUMAN	FBXO5	physical	28514442
APC10_HUMAN	ANAPC10	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.