UniProt ID | CDC16_HUMAN | |
---|---|---|
UniProt AC | Q13042 | |
Protein Name | Cell division cycle protein 16 homolog | |
Gene Name | CDC16 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 620 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle. | |
Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.. | |
Protein Sequence | MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Ubiquitination | RLRKRVRQYLDQQQY HHHHHHHHHHHHHHH | 40.04 | 21890473 | |
21 | Ubiquitination | LDQQQYQSALFWADK HHHHHHHHHHHHHHH | 23.23 | 21890473 | |
28 | Ubiquitination | SALFWADKVASLSRE HHHHHHHHHHHCCCC | 31.77 | - | |
31 | Phosphorylation | FWADKVASLSREEPQ HHHHHHHHCCCCCCH | 29.84 | 27174698 | |
33 | Phosphorylation | ADKVASLSREEPQDI HHHHHHCCCCCCHHH | 34.84 | 27174698 | |
41 | Phosphorylation | REEPQDIYWLAQCLY CCCCHHHHHHHHHHH | 11.58 | 29978859 | |
48 | Phosphorylation | YWLAQCLYLTAQYHR HHHHHHHHHHHHHHH | 15.05 | 29978859 | |
50 | Phosphorylation | LAQCLYLTAQYHRAA HHHHHHHHHHHHHHH | 9.73 | 29978859 | |
53 | Phosphorylation | CLYLTAQYHRAAHAL HHHHHHHHHHHHHHH | 7.27 | 29978859 | |
60 | Ubiquitination | YHRAAHALRSRKLDK HHHHHHHHHHCHHHH | 3.52 | 21890473 | |
101 | Acetylation | DMEEPINKRLFEKYL CCCCCHHHHHHHHHH | 51.72 | 26051181 | |
101 | Ubiquitination | DMEEPINKRLFEKYL CCCCCHHHHHHHHHH | 51.72 | - | |
105 (in isoform 2) | Ubiquitination | - | 45.44 | 21890473 | |
105 (in isoform 3) | Ubiquitination | - | 45.44 | 21890473 | |
106 | Ubiquitination | INKRLFEKYLKDESG HHHHHHHHHHCCCCC | 48.85 | 21890473 | |
106 (in isoform 1) | Ubiquitination | - | 48.85 | 21890473 | |
109 | Ubiquitination | RLFEKYLKDESGFKD HHHHHHHCCCCCCCC | 57.25 | - | |
109 | Acetylation | RLFEKYLKDESGFKD HHHHHHHCCCCCCCC | 57.25 | 26051181 | |
112 | Phosphorylation | EKYLKDESGFKDPSS HHHHCCCCCCCCCCC | 60.71 | 22199227 | |
114 (in isoform 2) | Ubiquitination | - | 12.96 | 21890473 | |
114 (in isoform 3) | Ubiquitination | - | 12.96 | 21890473 | |
115 | Ubiquitination | LKDESGFKDPSSDWE HCCCCCCCCCCCCCC | 72.72 | 21906983 | |
115 (in isoform 1) | Ubiquitination | - | 72.72 | 21890473 | |
118 | Phosphorylation | ESGFKDPSSDWEMSQ CCCCCCCCCCCCCCH | 51.57 | 29083192 | |
119 | Phosphorylation | SGFKDPSSDWEMSQS CCCCCCCCCCCCCHH | 52.73 | 29083192 | |
124 | Phosphorylation | PSSDWEMSQSSIKSS CCCCCCCCHHHHHHH | 18.52 | 29083192 | |
126 | Phosphorylation | SDWEMSQSSIKSSIC CCCCCCHHHHHHHHH | 27.07 | 29083192 | |
129 | Ubiquitination | EMSQSSIKSSICLLR CCCHHHHHHHHHHHH | 39.85 | - | |
138 | Ubiquitination | SICLLRGKIYDALDN HHHHHHCCHHHHCCC | 31.49 | - | |
140 | Phosphorylation | CLLRGKIYDALDNRT HHHHCCHHHHCCCCE | 9.92 | 29496907 | |
153 (in isoform 3) | Ubiquitination | - | 11.48 | 21890473 | |
153 (in isoform 2) | Ubiquitination | - | 11.48 | 21890473 | |
154 (in isoform 1) | Ubiquitination | - | 30.48 | 21890473 | |
154 | Ubiquitination | TLATYSYKEALKLDV EEEEECHHHHHCCCE | 30.48 | 21890473 | |
192 | Ubiquitination | LESLPLSKLCNEEQE HHHCCHHHHCCHHHH | 65.82 | - | |
208 | Ubiquitination | LRFLFENKLKKYNKP HHHHHHHHHHHCCCC | 55.26 | - | |
212 | Phosphorylation | FENKLKKYNKPSETV HHHHHHHCCCCCCCC | 27.17 | 29759185 | |
216 | Phosphorylation | LKKYNKPSETVIPES HHHCCCCCCCCCCCC | 47.73 | 29759185 | |
218 | Phosphorylation | KYNKPSETVIPESVD HCCCCCCCCCCCCCC | 28.24 | 29759185 | |
248 | Ubiquitination | HYYNCDFKMCYKLTS HHHCCCHHHEEECHH | 18.14 | - | |
254 | Phosphorylation | FKMCYKLTSVVMEKD HHHEEECHHHHHHCC | 18.47 | 21406692 | |
255 | Phosphorylation | KMCYKLTSVVMEKDP HHEEECHHHHHHCCC | 24.13 | 21406692 | |
260 | Ubiquitination | LTSVVMEKDPFHASC CHHHHHHCCCCCCCC | 53.24 | - | |
322 | Phosphorylation | KNEHARRYLSKATTL CCHHHHHHHHHCCCC | 15.13 | 30177828 | |
324 | Phosphorylation | EHARRYLSKATTLEK HHHHHHHHHCCCCCC | 16.00 | 21712546 | |
325 | Ubiquitination | HARRYLSKATTLEKT HHHHHHHHCCCCCCC | 47.35 | - | |
327 | Phosphorylation | RRYLSKATTLEKTYG HHHHHHCCCCCCCCC | 35.33 | 21712546 | |
328 | Phosphorylation | RYLSKATTLEKTYGP HHHHHCCCCCCCCCC | 37.47 | 21712546 | |
329 | Ubiquitination | YLSKATTLEKTYGPA HHHHCCCCCCCCCCC | 5.73 | 21890473 | |
396 | Phosphorylation | RFFSQALSIAPEDPF HHHHHHHHCCCCCCC | 21.51 | - | |
420 | Phosphorylation | FQNGEWKTAEKWFLD EECCCEEHHHHHHHH | 40.91 | - | |
422 (in isoform 2) | Ubiquitination | - | 56.93 | 21890473 | |
423 (in isoform 1) | Ubiquitination | - | 40.56 | 21890473 | |
423 | Ubiquitination | GEWKTAEKWFLDALE CCEEHHHHHHHHHHH | 40.56 | 21890473 | |
433 | Ubiquitination | LDALEKIKAIGNEVT HHHHHHHHHHCCCCC | 45.05 | - | |
440 | Phosphorylation | KAIGNEVTVDKWEPL HHHCCCCCCCCHHHH | 19.46 | - | |
443 | Ubiquitination | GNEVTVDKWEPLLNN CCCCCCCCHHHHHHH | 49.47 | - | |
460 | Ubiquitination | HVCRKLKKYAEALDY HHHHHHHHHHHHHHH | 61.19 | - | |
462 | Ubiquitination | CRKLKKYAEALDYHR HHHHHHHHHHHHHHH | 12.41 | 21890473 | |
478 | Ubiquitination | ALVLIPQNASTYSAI EEEEECCCCCHHHHH | 30.42 | 21890473 | |
490 | Phosphorylation | SAIGYIHSLMGNFEN HHHHHHHHHHCCHHH | 15.53 | 22817900 | |
504 (in isoform 3) | Ubiquitination | - | 17.43 | 21890473 | |
520 (in isoform 3) | Ubiquitination | - | 11.64 | 21890473 | |
553 | Ubiquitination | DFDVHTMKTLKNIIS CCCHHHHHHHHHHCC | 52.43 | - | |
555 (in isoform 2) | Ubiquitination | - | 3.14 | 21890473 | |
556 | Ubiquitination | VHTMKTLKNIISPPW HHHHHHHHHHCCCCC | 51.86 | 21890473 | |
556 (in isoform 1) | Ubiquitination | - | 51.86 | 21890473 | |
560 | Phosphorylation | KTLKNIISPPWDFRE HHHHHHCCCCCCHHH | 22.55 | 22167270 | |
571 (in isoform 2) | Ubiquitination | - | 32.05 | 21890473 | |
572 | Ubiquitination | FREFEVEKQTAEETG HHHHCCCHHHHHHHC | 59.11 | 2190698 | |
572 (in isoform 1) | Ubiquitination | - | 59.11 | 21890473 | |
574 | Phosphorylation | EFEVEKQTAEETGLT HHCCCHHHHHHHCCC | 47.29 | 21406692 | |
578 | Phosphorylation | EKQTAEETGLTPLET CHHHHHHHCCCCCCC | 29.06 | 26657352 | |
581 | Phosphorylation | TAEETGLTPLETSRK HHHHHCCCCCCCCCC | 27.46 | 29255136 | |
585 | Phosphorylation | TGLTPLETSRKTPDS HCCCCCCCCCCCCCC | 41.33 | 30108239 | |
586 | Phosphorylation | GLTPLETSRKTPDSR CCCCCCCCCCCCCCC | 23.54 | 29255136 | |
589 | Phosphorylation | PLETSRKTPDSRPSL CCCCCCCCCCCCCCH | 31.08 | 26074081 | |
592 | Phosphorylation | TSRKTPDSRPSLEET CCCCCCCCCCCHHHH | 47.50 | 26074081 | |
595 | Phosphorylation | KTPDSRPSLEETFEI CCCCCCCCHHHHEEE | 47.50 | 26074081 | |
599 | Phosphorylation | SRPSLEETFEIEMNE CCCCHHHHEEEEECH | 19.72 | 7736578 | |
607 | Phosphorylation | FEIEMNESDMMLETS EEEEECHHHHEEEEC | 26.29 | 27732954 | |
613 | Phosphorylation | ESDMMLETSMSDHST HHHHEEEECCCCCCC | 26.26 | 27732954 | |
614 | Phosphorylation | SDMMLETSMSDHST- HHHEEEECCCCCCC- | 13.60 | 27732954 | |
616 | Phosphorylation | MMLETSMSDHST--- HEEEECCCCCCC--- | 31.75 | 27732954 | |
619 | Phosphorylation | ETSMSDHST------ EECCCCCCC------ | 40.58 | 27732954 | |
620 | Phosphorylation | TSMSDHST------- ECCCCCCC------- | 38.93 | 27732954 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
560 | S | Phosphorylation |
| 14657031 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC16_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-560, AND MASSSPECTROMETRY. | |
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-560 AND THR-581, ANDMASS SPECTROMETRY. | |
"Combining protein-based IMAC, peptide-based IMAC, and MudPIT forefficient phosphoproteomic analysis."; Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,Yates J.R. III; J. Proteome Res. 7:1346-1351(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-560, AND MASSSPECTROMETRY. | |
"Phosphoproteome analysis of the human mitotic spindle."; Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.; Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-560 AND THR-581, ANDMASS SPECTROMETRY. | |
"A probability-based approach for high-throughput proteinphosphorylation analysis and site localization."; Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.; Nat. Biotechnol. 24:1285-1292(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-560 AND THR-581, ANDMASS SPECTROMETRY. | |
"Mitotic regulation of the human anaphase-promoting complex byphosphorylation."; Kraft C., Herzog F., Gieffers C., Mechtler K., Hagting A., Pines J.,Peters J.-M.; EMBO J. 22:6598-6609(2003). Cited for: PHOSPHORYLATION AT SER-112; SER-490; SER-560; THR-581; SER-595 ANDTHR-599. | |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-581, AND MASSSPECTROMETRY. |