| UniProt ID | JMJD4_HUMAN | |
|---|---|---|
| UniProt AC | Q9H9V9 | |
| Protein Name | JmjC domain-containing protein 4 | |
| Gene Name | JMJD4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 463 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MRAGPEPQALAGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRETRALADSHFRGLGVDVPGVGQAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPAGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDALDVDDYRFVYAGPAGSWSPFHADIFRSFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPALCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRFLQQELCAVQEEVSEWRDSMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 153 | Ubiquitination | QEYNSNPKEHMTLRD CCCCCCCCCCCCHHH | 65.58 | 21963094 | |
| 161 | Phosphorylation | EHMTLRDYITYWKEY CCCCHHHHHHHHHHH | 6.69 | 22817900 | |
| 163 | Phosphorylation | MTLRDYITYWKEYIQ CCHHHHHHHHHHHHH | 19.66 | 29759185 | |
| 164 | Phosphorylation | TLRDYITYWKEYIQA CHHHHHHHHHHHHHH | 12.62 | 29759185 | |
| 166 | Ubiquitination | RDYITYWKEYIQAGY HHHHHHHHHHHHHCC | 30.17 | 21906983 | |
| 166 (in isoform 2) | Ubiquitination | - | 30.17 | 21890473 | |
| 166 (in isoform 1) | Ubiquitination | - | 30.17 | 21890473 | |
| 168 | Phosphorylation | YITYWKEYIQAGYSS HHHHHHHHHHHCCCC | 8.46 | 28509920 | |
| 173 | Phosphorylation | KEYIQAGYSSPRGCL HHHHHHCCCCCCCEE | 14.70 | 22817900 | |
| 181 | Phosphorylation | SSPRGCLYLKDWHLC CCCCCEEEECCHHHC | 18.78 | 22817900 | |
| 183 | Ubiquitination | PRGCLYLKDWHLCRD CCCEEEECCHHHCCC | 45.26 | - | |
| 277 | Phosphorylation | GNLPYDVTSPALCDT CCCCCCCCCHHHCCC | 26.54 | 29214152 | |
| 278 | Phosphorylation | NLPYDVTSPALCDTH CCCCCCCCHHHCCCC | 14.18 | 29214152 | |
| 398 | Ubiquitination | AEKRLLVLREAAAED HHHHHHHHHHHHHHC | 4.06 | 27667366 | |
| 431 | Ubiquitination | VLASLVAHPDFQRVD HHHHHHHCCCHHCCC | 18.25 | 27667366 | |
| 431 (in isoform 2) | Ubiquitination | - | 18.25 | 21890473 | |
| 447 (in isoform 1) | Ubiquitination | - | 56.60 | 21890473 | |
| 447 | Ubiquitination | SAFSPQPKELLQQLR CCCCCCHHHHHHHHH | 56.60 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JMJD4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JMJD4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JMJD4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of JMJD4_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
