UniProt ID | APC16_HUMAN | |
---|---|---|
UniProt AC | Q96DE5 | |
Protein Name | Anaphase-promoting complex subunit 16 | |
Gene Name | ANAPC16 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 110 | |
Subcellular Localization | Cytoplasm . Nucleus . Chromosome, centromere, kinetochore . | |
Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.. | |
Protein Sequence | MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAASSSSSS ------CCCCCCCCC | 18.95 | 22814378 | |
9 | Phosphorylation | AASSSSSSAGGVSGS CCCCCCCCCCCCCCC | 32.64 | 25627689 | |
33 | Ubiquitination | SDLAPPRKALFTYPK HHCCCCCEEEEECCC | 56.04 | - | |
40 | Ubiquitination | KALFTYPKGAGEMLE EEEEECCCCHHHCCC | 51.48 | 21906983 | |
45 | Sulfoxidation | YPKGAGEMLEDGSER CCCCHHHCCCCCCHH | 4.93 | 21406390 | |
57 | Phosphorylation | SERFLCESVFSYQVA CHHEEEEHHHHHHHH | 27.71 | 22067460 | |
61 | Phosphorylation | LCESVFSYQVASTLK EEEHHHHHHHHHHHH | 8.78 | 27642862 | |
68 | Ubiquitination | YQVASTLKQVKHDQQ HHHHHHHHHHHHHHH | 53.81 | - | |
71 | Acetylation | ASTLKQVKHDQQVAR HHHHHHHHHHHHHHH | 38.68 | 25953088 | |
97 | Ubiquitination | EADEWRFKPIEQLLG HHCCCCCCCHHHHHC | 36.19 | 21906983 | |
106 | Phosphorylation | IEQLLGFTPSSG--- HHHHHCCCCCCC--- | 22.06 | 21712546 | |
108 | Phosphorylation | QLLGFTPSSG----- HHHCCCCCCC----- | 44.63 | 21712546 | |
109 | Phosphorylation | LLGFTPSSG------ HHCCCCCCC------ | 50.12 | 21712546 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APC16_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APC16_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APC16_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APC7_HUMAN | ANAPC7 | physical | 25490258 | |
CDC27_HUMAN | CDC27 | physical | 25490258 | |
APC7_HUMAN | ANAPC7 | physical | 26344197 | |
CDC26_HUMAN | CDC26 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...