UniProt ID | GNPTG_HUMAN | |
---|---|---|
UniProt AC | Q9UJJ9 | |
Protein Name | N-acetylglucosamine-1-phosphotransferase subunit gamma | |
Gene Name | GNPTG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 305 | |
Subcellular Localization | Secreted . Golgi apparatus . | |
Protein Description | Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high mannose glycans of the acceptor to the catalytic alpha and beta subunits (GNPTAB). Enhances the rate of N-acetylglucosamine-1-phosphate transfer to the oligosaccharides of acid hydrolase acceptors.. | |
Protein Sequence | MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | LLLLLGLSAGGPAPA HHHHHHHHCCCCCCC | 24.06 | 20068231 | |
56 | Phosphorylation | LQAKRDPSPVSGPVH HHCCCCCCCCCCCEE | 42.07 | 23312004 | |
87 | Ubiquitination | KYEFCPFHNVTQHEQ CEEECCCCCCCCCCE | 17.00 | 22817900 | |
88 | N-linked_Glycosylation | YEFCPFHNVTQHEQT EEECCCCCCCCCCEE | 38.62 | UniProtKB CARBOHYD | |
115 | N-linked_Glycosylation | WHEWEIANNTFTGMW EEEEEECCCEECCEE | 54.45 | 15532026 | |
133 | Phosphorylation | GDACRSRSRQSKVEL CHHHHHHCCCCHHHH | 35.60 | - | |
144 | Ubiquitination | KVELACGKSNRLAHV HHHHHHCCCCCCCCC | 44.43 | 29967540 | |
207 | Ubiquitination | ITPQGHEKLLRTLFE CCHHHHHHHHHHHHH | 47.34 | 22817900 | |
211 | O-linked_Glycosylation | GHEKLLRTLFEDAGY HHHHHHHHHHHHCCC | 35.45 | OGP | |
223 | Ubiquitination | AGYLKTPEENEPTQL CCCCCCCCCCCCCCC | 77.88 | 22817900 | |
228 | O-linked_Glycosylation | TPEENEPTQLEGGPD CCCCCCCCCCCCCCC | 39.34 | OGP | |
253 | Phosphorylation | RKAHKELSKEIKRLK HHHHHHHHHHHHHHH | 29.36 | - | |
271 | O-linked_Glycosylation | TQHGIPYTRPTETSN HHCCCCCCCCCCCCC | 25.48 | 55832741 | |
274 | O-linked_Glycosylation | GIPYTRPTETSNLEH CCCCCCCCCCCCCHH | 48.91 | 55832747 | |
276 | O-linked_Glycosylation | PYTRPTETSNLEHLG CCCCCCCCCCCHHHC | 25.95 | 55832753 | |
277 | O-linked_Glycosylation | YTRPTETSNLEHLGH CCCCCCCCCCHHHCC | 32.93 | 55832759 | |
286 | O-linked_Glycosylation | LEHLGHETPRAKSPE CHHHCCCCCCCCCHH | 16.64 | 55832763 | |
291 | O-linked_Glycosylation | HETPRAKSPEQLRGD CCCCCCCCHHHHCCC | 32.46 | 55833755 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNPTG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNPTG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNPTG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPSB3_HUMAN | SPSB3 | physical | 28514442 | |
GNPTA_HUMAN | GNPTAB | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
252605 | Mucolipidosis type III complementation group C (MLIIIC) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...