| UniProt ID | SPSB3_HUMAN | |
|---|---|---|
| UniProt AC | Q6PJ21 | |
| Protein Name | SPRY domain-containing SOCS box protein 3 | |
| Gene Name | SPSB3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 355 | |
| Subcellular Localization | ||
| Protein Description | May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.. | |
| Protein Sequence | MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIPSAVPVTGESFCDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 119 | Phosphorylation | KSSATLLSCDNRKVS CCCCEEEEECCCEEE | 23.65 | 21712546 | |
| 126 | Phosphorylation | SCDNRKVSFHMEYSC EECCCEEEEEEEECC | 16.69 | - | |
| 131 | Phosphorylation | KVSFHMEYSCGTAAI EEEEEEEECCCCEEE | 11.16 | 29759185 | |
| 132 | Phosphorylation | VSFHMEYSCGTAAIR EEEEEEECCCCEEEE | 7.86 | 21712546 | |
| 142 | Ubiquitination | TAAIRGTKELGEGQH CEEEECCCCCCCCCE | 54.49 | 22817900 | |
| 170 | Phosphorylation | DMMVGIGTSDVDLDK CEEEECCCCCCCHHH | 21.60 | - | |
| 197 | Ubiquitination | EDSWGLSYTGLLHHK CCCCCCEEEEECCCC | 15.18 | 21890473 | |
| 246 | Ubiquitination | CIGVAATKLQNKRFY EEEEEEEECCCCCCH | 43.26 | 29967540 | |
| 253 | Phosphorylation | KLQNKRFYPMVCSTA ECCCCCCHHHHCHHH | 8.41 | - | |
| 258 | Phosphorylation | RFYPMVCSTAARSSM CCHHHHCHHHHHHCC | 15.07 | - | |
| 275 | Phosphorylation | TRSCASATSLQYLCC CHHCCCCHHHHHHHH | 27.72 | - | |
| 276 | Phosphorylation | RSCASATSLQYLCCH HHCCCCHHHHHHHHH | 17.12 | - | |
| 279 | Phosphorylation | ASATSLQYLCCHRLR CCCHHHHHHHHHHHH | 13.65 | - | |
| 318 | Phosphorylation | NKLGWVLSMSCSRRK HHHHHHHHCCCCCCC | 10.07 | - | |
| 320 | Phosphorylation | LGWVLSMSCSRRKAP HHHHHHCCCCCCCCC | 12.93 | - | |
| 322 | Phosphorylation | WVLSMSCSRRKAPVS HHHHCCCCCCCCCCC | 28.01 | - | |
| 325 | Ubiquitination | SMSCSRRKAPVSDPQ HCCCCCCCCCCCCHH | 56.80 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPSB3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPSB3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPSB3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPSB3_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
