UniProt ID | ANGL4_HUMAN | |
---|---|---|
UniProt AC | Q9BY76 | |
Protein Name | Angiopoietin-related protein 4 | |
Gene Name | ANGPTL4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 406 | |
Subcellular Localization | Secreted . Secreted, extracellular space, extracellular matrix. The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4 (By similarity).. | |
Protein Description | Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation (By similarity).. | |
Protein Sequence | MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MSGAPTAGAALML --CCCCCHHHHHHHH | 36.87 | 22468782 | |
17 | Phosphorylation | ALMLCAATAVLLSAQ HHHHHHHHHHHHHCC | 9.97 | 22468782 | |
30 | Phosphorylation | AQGGPVQSKSPRFAS CCCCCCCCCCCCCCC | 35.02 | 46163247 | |
87 | O-linked_Glycosylation | CQGTEGSTDLPLAPE HCCCCCCCCCCCCCH | 53.03 | OGP | |
164 | Methylation | AKPARRKRLPEMAQP HHHHHHCCCHHHCCC | 54.38 | - | |
177 | N-linked_Glycosylation | QPVDPAHNVSRLHRL CCCCCCCCHHHHHCC | 35.25 | UniProtKB CARBOHYD | |
180 | Methylation | DPAHNVSRLHRLPRD CCCCCHHHHHCCCHH | 30.17 | - | |
219 | Phosphorylation | FLVNCKMTSDGGWTV EEEEEEEECCCCEEE | 14.79 | 22210691 | |
220 | Phosphorylation | LVNCKMTSDGGWTVI EEEEEEECCCCEEEE | 30.66 | 22210691 | |
234 | Phosphorylation | IQRRHDGSVDFNRPW EEECCCCCCCCCCCH | 25.27 | 22210691 | |
244 | Phosphorylation | FNRPWEAYKAGFGDP CCCCHHHHHCCCCCC | 7.00 | 22210691 | |
315 | O-linked_Glycosylation | VAGQLGATTVPPSGL CCCCCCCEECCCCCC | 26.91 | OGP | |
316 | O-linked_Glycosylation | AGQLGATTVPPSGLS CCCCCCEECCCCCCC | 30.40 | OGP | |
382 | Phosphorylation | KKGIFWKTWRGRYYP HCCCCCHHCCCCCCC | 15.81 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANGL4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANGL4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANGL4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACTB_HUMAN | ACTB | physical | 22573825 | |
WDR47_HUMAN | WDR47 | physical | 28514442 | |
NMT2_HUMAN | NMT2 | physical | 28514442 | |
P20D2_HUMAN | PM20D2 | physical | 28514442 | |
ADPPT_HUMAN | AASDHPPT | physical | 28514442 | |
NMT1_HUMAN | NMT1 | physical | 28514442 | |
ITIH2_HUMAN | ITIH2 | physical | 28514442 | |
ARMC8_HUMAN | ARMC8 | physical | 28514442 | |
DNJB4_HUMAN | DNAJB4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...