dbPTM

ARY2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ARY2_HUMAN
UniProt AC	P11245
Protein Name	Arylamine N-acetyltransferase 2
Gene Name	NAT2
Organism	Homo sapiens (Human).
Sequence Length	290
Subcellular Localization	Cytoplasm.
Protein Description	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens..
Protein Sequence	MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	AYFERIGYKNSRNKL HHHHHHCCCCCCCCC	12.48	19702290
25	Phosphorylation	KLDLETLTDILEHQI CCCHHHHHHHHHHHH	28.54	-
188	Acetylation	LPKKKHQKIYLFTLE CCCCCCCEEEEEEEC	32.79	27178108

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ARY2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ARY2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ARY2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
STAR7_HUMAN	STARD7	physical	26186194
ZN346_HUMAN	ZNF346	physical	26186194
KLK5_HUMAN	KLK5	physical	26186194
RAD51_HUMAN	RAD51	physical	25640309
STAR7_HUMAN	STARD7	physical	28514442
ZN346_HUMAN	ZNF346	physical	28514442
KLK5_HUMAN	KLK5	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB00316	Acetaminophen
DB01068	Clonazepam
DB00250	Dapsone
DB04953	Ezogabine
DB00951	Isoniazid
DB01015	Sulfamethoxazole

Regulatory Network of ARY2_HUMAN

Related Literatures of Post-Translational Modification