UniProt ID | DOB_HUMAN | |
---|---|---|
UniProt AC | P13765 | |
Protein Name | HLA class II histocompatibility antigen, DO beta chain | |
Gene Name | HLA-DOB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 273 | |
Subcellular Localization |
Endosome membrane Single-pass type I membrane protein. Lysosome membrane Single-pass type I membrane protein. Complexes with HLA-DM molecule during intracellular transport and in endosomal/lysosomal compartments. Heterotetramerization is necessary |
|
Protein Description | Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM.. | |
Protein Sequence | MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | N-linked_Glycosylation | KADCYFTNGTEKVQF EEEEEEECCCCEEEE | 45.55 | UniProtKB CARBOHYD | |
63 | Phosphorylation | FIFNLEEYVRFDSDV HHCCHHHHCCCCCCC | 6.37 | - | |
68 | Phosphorylation | EEYVRFDSDVGMFVA HHHCCCCCCCHHHHH | 31.33 | - | |
97 | Phosphorylation | RLDLLERSRQAVDGV HHHHHHHHHHHHHHH | 21.26 | 26074081 | |
272 | Phosphorylation | RAVLLPQSC------ EEEECCCCC------ | 21.61 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DOB_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...