UniProt ID | EBNA5_EBVG | |
---|---|---|
UniProt AC | P0C732 | |
Protein Name | Epstein-Barr nuclear antigen leader protein | |
Gene Name | EBNA-LP | |
Organism | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). | |
Sequence Length | 506 | |
Subcellular Localization | Host nucleus. | |
Protein Description | Plays an important role in the establishment of B-cell immortalization by acting as an EBNA2 coactivator. This transcriptional activation preferentially enhances the expression of the major viral protein LMP1. The interaction between EBNA-LP and host SP100 correlates with coactivation of EBNA2 and the relocalization of SP100 from PML nuclear bodies into nucleoplasm (By similarity).. | |
Protein Sequence | MGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPLRPRPRPPARSLREWLLRIRDHFEPPTVTTQRQSVYIEEEEDED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Phosphorylation | LRRHRSPSPTRGGQE HHHCCCCCCCCCCCC | 39.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBNA5_EBVG !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBNA5_EBVG !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBNA5_EBVG !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...