UniProt ID | GFRP_HUMAN | |
---|---|---|
UniProt AC | P30047 | |
Protein Name | GTP cyclohydrolase 1 feedback regulatory protein | |
Gene Name | GCHFR | |
Organism | Homo sapiens (Human). | |
Sequence Length | 84 | |
Subcellular Localization | Nucleus . Nucleus membrane . Cytoplasm, cytosol . | |
Protein Description | Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine.. | |
Protein Sequence | MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPYLLISTQI -----CCEEEEEEEE | 16.91 | 23401153 | |
7 | Phosphorylation | -MPYLLISTQIRMEV -CCEEEEEEEEEEEC | 17.77 | 23403867 | |
8 | Phosphorylation | MPYLLISTQIRMEVG CCEEEEEEEEEEECC | 22.48 | 23401153 | |
17 | Phosphorylation | IRMEVGPTMVGDEQS EEEECCCCCCCCCCC | 20.68 | 23403867 | |
35 | Phosphorylation | LMQHLGASKRRALGN HHHHHCHHHHHHHCC | 25.54 | 23401153 | |
36 | Acetylation | MQHLGASKRRALGNN HHHHCHHHHHHHCCC | 45.42 | 24885225 | |
45 | Phosphorylation | RALGNNFYEYYVDDP HHHCCCCEEEECCCC | 12.73 | 27259358 | |
47 | Phosphorylation | LGNNFYEYYVDDPPR HCCCCEEEECCCCCC | 9.45 | - | |
48 | Phosphorylation | GNNFYEYYVDDPPRI CCCCEEEECCCCCCE | 5.86 | - | |
48 | Ubiquitination | GNNFYEYYVDDPPRI CCCCEEEECCCCCCE | 5.86 | - | |
59 | Ubiquitination | PPRIVLDKLERRGFR CCCEEEHHHHHCCCE | 48.35 | - | |
71 | Phosphorylation | GFRVLSMTGVGQTLV CCEEEEEECCCCEEE | 25.91 | 24247654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GFRP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GFRP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GFRP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KKCC2_HUMAN | CAMKK2 | physical | 28514442 | |
PEBB_HUMAN | CBFB | physical | 28514442 | |
PUSL1_HUMAN | PUSL1 | physical | 28514442 | |
NEBL_HUMAN | NEBL | physical | 28514442 | |
IF4G1_HUMAN | EIF4G1 | physical | 28514442 | |
OBSL1_HUMAN | OBSL1 | physical | 28514442 | |
DOC11_HUMAN | DOCK11 | physical | 28514442 | |
HBS1L_HUMAN | HBS1L | physical | 28514442 | |
I2BP2_HUMAN | IRF2BP2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...