dbPTM

PUSL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PUSL1_HUMAN
UniProt AC	Q8N0Z8
Protein Name	tRNA pseudouridine synthase-like 1
Gene Name	PUSL1
Organism	Homo sapiens (Human).
Sequence Length	303
Subcellular Localization
Protein Description
Protein Sequence	MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	HLDVQRRSGRPPFPP CCCHHHHCCCCCCCH	41.15	28258704
100	Phosphorylation	VLAEALNTHLRHPAI HHHHHHHHHHCCHHH	24.12	28258704
105 (in isoform 2)	Ubiquitination	-	23.97	21906983
186	Phosphorylation	SAFQSAGSPVPSPVR HHHHCCCCCCCCCCE	23.57	20886841
199	Phosphorylation	VRTLRRVSVSPGQAS CEEEEEEECCCCCCC	18.31	25849741
201	Phosphorylation	TLRRVSVSPGQASPL EEEEEECCCCCCCCC	18.79	28348404
266	Ubiquitination	ESQDPLGKHQTRVAP HCCCCCCCCCCCCCC	39.98	27667366
266 (in isoform 1)	Ubiquitination	-	39.98	21906983
289	Ubiquitination	VLYGNLGAASCTLQG HHHCCCCCCEEEECC	10.20	22817900
301	Phosphorylation	LQGPQFGSHG----- ECCCCCCCCC-----	26.73	26471730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PUSL1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PUSL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PUSL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PUSL1_HUMAN

Related Literatures of Post-Translational Modification