| UniProt ID | ARF_HUMAN | |
|---|---|---|
| UniProt AC | Q8N726 | |
| Protein Name | Tumor suppressor ARF {ECO:0000305} | |
| Gene Name | CDKN2A {ECO:0000312|EMBL:AAM77919.1, ECO:0000312|HGNC:HGNC:1787} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 132 | |
| Subcellular Localization |
Nucleus, nucleolus . Nucleus, nucleoplasm . Isoform smARF: Mitochondrion . |
|
| Protein Description | Capable of inducing cell cycle arrest in G1 and G2 phases. Acts as a tumor suppressor. Binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis in a p53-independent manner by preventing the activation of cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulates BCL6-induced transcriptional repression. Binds to E2F1 and MYC and blocks their transcriptional activator activity but has no effect on MYC transcriptional repression. Binds to TOP1/TOPOI and stimulates its activity. This complex binds to rRNA gene promoters and may play a role in rRNA transcription and/or maturation. Interacts with NPM1/B23 and promotes its polyubiquitination and degradation, thus inhibiting rRNA processing. Interacts with COMMD1 and promotes its 'Lys63'-linked polyubiquitination. Interacts with UBE2I/UBC9 and enhances sumoylation of a number of its binding partners including MDM2 and E2F1. Binds to HUWE1 and represses its ubiquitin ligase activity. May play a role in controlling cell proliferation and apoptosis during mammary gland development. Isoform smARF may be involved in regulation of autophagy and caspase-independent cell death; the short-lived mitochondrial isoform is stabilized by C1QBP.. | |
| Protein Sequence | MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MVRRFLVTLRIRRAC CCCHHHHHHHHHHHH | - | ||
| 26 (in isoform 2) | Phosphorylation | - | 29632367 | ||
| 31 | Phosphorylation | VVHIPRLTGEWAAPG EEECCCCCCCCCCCC | - | ||
| 45 (in isoform 2) | Phosphorylation | - | 23403867 | ||
| 73 | Phosphorylation | HDDGQRPSGGAAAAP CCCCCCCCCCCCCCC | 29632367 | ||
| 92 | Phosphorylation | QLRRPRHSHPTRARR CCCCCCCCCCCCHHC | 23403867 | ||
| 115 | Methylation | AGGAAPGRGAAGRAR CCCCCCCCCHHCCCC | - | ||
| 120 | Methylation | PGRGAAGRARCLGPS CCCCHHCCCCCCCCC | - | ||
| 122 | Methylation | RGAAGRARCLGPSAR CCHHCCCCCCCCCCC | - | ||
| 129 | Methylation | RCLGPSARGPG---- CCCCCCCCCCC---- | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 8 | T | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | SIVA1 | O15304 | PMID:23462994 |
| - | K | Ubiquitination | E3 ubiquitin ligase | TRIP12 | Q14669 | PMID:22199232 |
| - | K | Ubiquitination | E3 ubiquitin ligase | MKRN1 | Q9UHC7 | PMID:23104211 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
