UniProt ID | VHL_HUMAN | |
---|---|---|
UniProt AC | P40337 | |
Protein Name | von Hippel-Lindau disease tumor suppressor | |
Gene Name | VHL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Isoform 1: Cytoplasm. Membrane Peripheral membrane protein. Nucleus. Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated. Colocalizes with ADRB2 at the cell membrane. Isoform 3: Cytoplasm. Nucleus. Equally |
|
Protein Description | Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.. | |
Protein Sequence | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Phosphorylation | EEDGGEESGAEESGP CCCCCCCCCCCCCCC | 38.71 | 22817900 | |
38 | Phosphorylation | EESGAEESGPEESGP CCCCCCCCCCCCCCC | 51.67 | 22817900 | |
43 | Phosphorylation | EESGPEESGPEELGA CCCCCCCCCCCCCCH | 58.97 | 22817900 | |
65 | Phosphorylation | RPRPVLRSVNSREPS CCCCCCCCCCCCCCC | 22.84 | 28450419 | |
68 | Phosphorylation | PVLRSVNSREPSQVI CCCCCCCCCCCCEEE | 35.55 | 28450419 | |
72 | Phosphorylation | SVNSREPSQVIFCNR CCCCCCCCEEEEECC | 32.12 | 28450419 | |
79 | Methylation | SQVIFCNRSPRVVLP CEEEEECCCCCEEEE | 49.58 | 80702285 | |
80 | Phosphorylation | QVIFCNRSPRVVLPV EEEEECCCCCEEEEE | 11.76 | 27251275 | |
100 | Phosphorylation | GEPQPYPTLPPGTGR CCCCCCCCCCCCCCC | 46.16 | - | |
105 | Phosphorylation | YPTLPPGTGRRIHSY CCCCCCCCCCEECEE | 33.03 | - | |
111 | Phosphorylation | GTGRRIHSYRGHLWL CCCCEECEECCCEEE | 17.72 | 22071692 | |
112 | Phosphorylation | TGRRIHSYRGHLWLF CCCEECEECCCEEEE | 13.37 | - | |
143 (in isoform 3) | Ubiquitination | - | 49.27 | 21890473 | |
155 (in isoform 2) | Ubiquitination | - | 6.84 | 21890473 | |
159 | Neddylation | TLPVYTLKERCLQVV EEEEEEHHHHHHHHH | 35.00 | - | |
159 | Ubiquitination | TLPVYTLKERCLQVV EEEEEEHHHHHHHHH | 35.00 | - | |
168 | Phosphorylation | RCLQVVRSLVKPENY HHHHHHHHHCCHHHH | 26.38 | - | |
171 | Sumoylation | QVVRSLVKPENYRRL HHHHHHCCHHHHHHH | 52.48 | - | |
171 | Ubiquitination | QVVRSLVKPENYRRL HHHHHHCCHHHHHHH | 52.48 | - | |
171 | Sumoylation | QVVRSLVKPENYRRL HHHHHHCCHHHHHHH | 52.48 | - | |
171 | Neddylation | QVVRSLVKPENYRRL HHHHHHCCHHHHHHH | 52.48 | - | |
175 | Phosphorylation | SLVKPENYRRLDIVR HHCCHHHHHHHHHHH | 8.75 | 29496907 | |
183 | Phosphorylation | RRLDIVRSLYEDLED HHHHHHHHHHHHHHH | 25.14 | - | |
185 | Phosphorylation | LDIVRSLYEDLEDHP HHHHHHHHHHHHHCC | 14.51 | 28796482 | |
196 | Ubiquitination | EDHPNVQKDLERLTQ HHCCCHHHHHHHHHH | 61.06 | 21890473 | |
196 | Neddylation | EDHPNVQKDLERLTQ HHCCCHHHHHHHHHH | 61.06 | - | |
196 (in isoform 1) | Ubiquitination | - | 61.06 | 21890473 | |
202 | Phosphorylation | QKDLERLTQERIAHQ HHHHHHHHHHHHHHH | 34.31 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
33 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
38 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
43 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
68 | S | Phosphorylation | Kinase | GSK3B | G1T8E2 | PSP |
68 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
72 | S | Phosphorylation | Kinase | AURKA | O14965 | GPS |
72 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
100 | T | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
105 | T | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
111 | S | Phosphorylation | Kinase | CHEK2 | O96017 | GPS |
112 | Y | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
168 | S | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
175 | Y | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
183 | S | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
202 | T | Phosphorylation | Kinase | NEK1 | Q96PY6 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VHL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VHL_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00021 | Renal cell carcinoma | |||||
H00236 | Congenital polycythemia; Familial erythrocytosis (ECYT) | |||||
H00559 | von Hippel-Lindau syndrome | |||||
OMIM Disease | ||||||
171300 | Pheochromocytoma (PCC) | |||||
193300 | von Hippel-Lindau disease (VHLD) | |||||
263400 | Erythrocytosis, familial, 2 (ECYT2) | |||||
144700 | Renal cell carcinoma (RCC) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...